DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and CG31681

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster


Alignment Length:255 Identity:73/255 - (28%)
Similarity:115/255 - (45%) Gaps:16/255 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LILLPLVLFTSSAASQILYPPQYTKNRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIIDERWI 67
            |:|..||.....|.:..:..|:   .|||||........|:|:|:|  .:..|.|||.|..:|.|
  Fly     5 LLLSILVSIAGLACAARIPGPE---ERIVGGSYIPIEYVPWQVSVQ--NNSLHCCGGVIYSDRAI 64

  Fly    68 ITAAHCTRGRQATAFRVLTGTQDLHQNGSKYYYPDRIVEHSNYAPRKYR-NDIALLHLNESIVFD 131
            :|||||......|...|..|: .....|.:.....:.:.|..|.|:.|. .|||:|.|...:...
  Fly    65 LTAAHCLSNVTVTDLSVRAGS-SYWSKGGQVLKVLKTIAHPKYVPKLYNPYDIAVLILEAPLRLG 128

  Fly   132 NATQPVELDHEALVPGSRLLLTGWG-TLSLGGDVPARLQSLEVNYVPFEQCRAAHDNSTRVDIGH 195
            ...:.:.|..:..|.|:.:|.:||| |......:...||.:.|..:....|..|:.: ..:.|..
  Fly   129 GTVKKIPLAEQTPVAGTIVLTSGWGYTRENSSFLWPILQGVHVAILNRTDCLKAYKH-VNITIDM 192

  Fly   196 VCTFNDKGRGACHGDSGGPLVHNGK-----LVALVNWGLPCAKGYPDAHASISYYHDFIR 250
            :|....:. ..|.|||||||:...|     |:.:|:||..|... |..:..|:::|::|:
  Fly   193 ICADGQRW-DTCQGDSGGPLIETTKGGHRQLIGMVSWGDGCGTN-PGVYEDIAFFHNWIK 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 66/226 (29%)
Tryp_SPc 30..252 CDD:238113 66/228 (29%)
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 66/226 (29%)
Tryp_SPc 29..250 CDD:238113 65/226 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.