DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and CG31269

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster


Alignment Length:262 Identity:130/262 - (49%)
Similarity:159/262 - (60%) Gaps:14/262 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLILLPLVLFTSSAASQI--------LYPPQYTKNRIVGGEEAAAGLAPYQISLQGIGSGAHSC 57
            :|||||.|....|..|.:|        .|..|    ||:||:.|..|.|||||||||| ||||||
  Fly     5 VLLILLGLSGLVSITAIRIKGNSTDGRFYKDQ----RIIGGQAAEDGFAPYQISLQGI-SGAHSC 64

  Fly    58 GGAIIDERWIITAAHCTRGRQATAFRVLTGTQDLHQNGSKYYYPDRIVEHSNYAPRKYRNDIALL 122
            |||||:|.:::|||||..........|:|||...:|.|.:|:. ..|..|.||...:..||||||
  Fly    65 GGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRYFL-KAIHIHCNYDNPEMHNDIALL 128

  Fly   123 HLNESIVFDNATQPVELDHEALVPGSRLLLTGWGTLSLGGDVPARLQSLEVNYVPFEQCRAAHDN 187
            .|.|.|.:|..|||:.|....:.||..::|||||:..|.|..|..||.|.:.|||..:|:|...|
  Fly   129 ELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSN 193

  Fly   188 STRVDIGHVCTFNDKGRGACHGDSGGPLVHNGKLVALVNWGLPCAKGYPDAHASISYYHDFIRTH 252
            ....|:||:|||:..|.||||||||||||.||.||.|||||.|||.|.||.|||:.:|.|:||..
  Fly   194 DEDCDVGHICTFSRLGEGACHGDSGGPLVSNGYLVGLVNWGWPCATGVPDVHASVYFYRDWIRNV 258

  Fly   253 LS 254
            :|
  Fly   259 MS 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 116/219 (53%)
Tryp_SPc 30..252 CDD:238113 117/221 (53%)
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 116/219 (53%)
Tryp_SPc 38..258 CDD:238113 117/221 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BRU4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D104368at6960
OrthoFinder 1 1.000 - - FOG0007620
OrthoInspector 1 1.000 - - mtm9682
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.