DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and Klk15

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_777354.1 Gene:Klk15 / 317652 MGIID:2447533 Length:254 Species:Mus musculus


Alignment Length:266 Identity:79/266 - (29%)
Similarity:116/266 - (43%) Gaps:41/266 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ILLPLVLFTSSAASQILYPPQYTKNRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIIDERWII 68
            :||..||..|:|..         .::::.|||......|:|::|  ...|..:||..:|..||::
Mouse     3 LLLAFVLLVSAAQD---------GDKVLEGEECVPHSQPWQVAL--FERGRFNCGAFLISPRWVL 56

  Fly    69 TAAHCTRGRQATAFRVLTGTQDLHQNGSKYYYPD------RIVEHSNYAPRKYRNDIALLHLNES 127
            |||||    |....||..|..:|.    |:..|:      ||:.|..|..|.:|:||.||.|.:.
Mouse    57 TAAHC----QTRFMRVRLGEHNLR----KFDGPEQLRSVSRIIPHPGYEARTHRHDIMLLRLFKP 113

  Fly   128 IVFDNATQPVELDHEALVPGSRLLLTGWGTLS------LGGD-----VPARLQSLEVNYVPFEQC 181
            .......:||.|.....:.|...:::|||.||      .|..     :|..|....::.:....|
Mouse   114 ARLTAYVRPVALPRRCPLIGEDCVVSGWGLLSDNNPGATGSQKSHVRLPDTLHCANISIISEASC 178

  Fly   182 RAAHDNSTRVDIGHVCT-FNDKGRGACHGDSGGPLVHNGKLVALVNWG-LPC-AKGYPDAHASIS 243
            .  .|...||....||. ....|..:|.||||||||..|.|..:|:|| :|| ....|..:..:.
Mouse   179 N--KDYPGRVLPTMVCAGVEGGGTDSCEGDSGGPLVCGGALQGIVSWGDVPCDTTTKPGVYTKVC 241

  Fly   244 YYHDFI 249
            .|.::|
Mouse   242 SYLEWI 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 72/239 (30%)
Tryp_SPc 30..252 CDD:238113 73/240 (30%)
Klk15NP_777354.1 Tryp_SPc 23..247 CDD:238113 72/235 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.