DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and Prtn3

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_038934901.1 Gene:Prtn3 / 314615 RGDID:1304898 Length:422 Species:Rattus norvegicus


Alignment Length:233 Identity:79/233 - (33%)
Similarity:111/233 - (47%) Gaps:18/233 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 NRIVGGEEAAAGLAPYQISLQ-GIGSGAHSCGGAIIDERWIITAAHCTRGRQATAFRVLTGTQD- 90
            ::||||.||.....||..||| ....|:|.|||.:|..|:::|||||.:........|:.|..| 
  Rat   196 SKIVGGHEARPHSRPYVASLQLSRSPGSHFCGGTLIHPRFVLTAAHCLQDISWQLVTVVLGAHDL 260

  Fly    91 LHQNGSKYYYPDRIVEHSNYAPRKYRNDIALLHLNE--SIVFDNATQPVELDHEALVPGSRLLLT 153
            |.....:..:....|..:||.|.:..||:.||.||.  |:....|...:....::|..|::.|..
  Rat   261 LSSEPEQQKFTITQVFENNYNPEETLNDVLLLQLNRPASLGKQVAVASLPQQDQSLSQGTQCLAM 325

  Fly   154 GWGTLSLGGDVPARLQSLEVNYVPFEQCRAAHDNSTRVDIGHVCTF-NDKGRGACHGDSGGPLVH 217
            |||.|......|..|..|.|..|.| .|| .|         :|||. ..:..|.|.|||||||:.
  Rat   326 GWGRLGTRAPTPRVLHELNVTVVTF-LCR-EH---------NVCTLVPRRAAGICFGDSGGPLIC 379

  Fly   218 NGKLVALVNWGL-PCAK-GYPDAHASISYYHDFIRTHL 253
            ||.|..:.::.: .||. .:||..|.:|.|.::|.:.|
  Rat   380 NGILHGVDSFVIRECASLQFPDFFARVSMYVNWIHSVL 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 77/226 (34%)
Tryp_SPc 30..252 CDD:238113 78/228 (34%)
Prtn3XP_038934901.1 Tryp_SPc 198..416 CDD:238113 78/228 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.