DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and CG14780

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster


Alignment Length:264 Identity:78/264 - (29%)
Similarity:123/264 - (46%) Gaps:28/264 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LVLFTSSAASQILYPPQYTKNRIVGGEEAAAGLAPYQISLQ------GIGSGAHSCGGAIIDERW 66
            |..|..:.|:..|...|  ::||:.|..|.|....:.:|::      ..||| |.||||:|..|.
  Fly    13 LFWFLLACAAADLQENQ--QSRIINGSVAKADETRHLVSIRLLRHDNNFGSG-HICGGALIAPRK 74

  Fly    67 IITAAHC------TRGRQATAFRVLTGTQDL--HQNGSKYYYPDRIVEHSNYAPRKYRNDIALLH 123
            ::|||||      .|.|:|:.|.|:.||.:.  |:||:.......:.....::|...|:|:.:|.
  Fly    75 VLTAAHCLYNNQRKRFRRASEFVVVLGTLNRFEHRNGTIVSQVSSMAYMHTFSPDSMRDDVGILF 139

  Fly   124 LNESIVFDN------ATQPVELDHEALVPGSRLLLTGWGTLSLGGDVPARLQSLEVNYVPFEQCR 182
            |...:....      ...|::|..:...||....:.|||... ...:...|.:..|:.:..:.||
  Fly   140 LRTGLPMSPGGGVHLTVAPIQLAGQITPPGKLCQVAGWGRTE-QSSLSNILLTANVSTIRHQTCR 203

  Fly   183 AAHDNSTRVDIGHVCTFN-DKGRGACHGDSGGPLVHNGKLVALVNWGLPCAK-GYPDAHASISYY 245
            ..:.:....  |.:|... ..|..:|.|||||||||.|:||.:|:||..||: |.|..:..:.||
  Fly   204 MIYRSGLLP--GMMCAGRLQGGTDSCQGDSGGPLVHEGRLVGVVSWGYGCAEPGLPGVYVDVEYY 266

  Fly   246 HDFI 249
            ..:|
  Fly   267 RQWI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 72/241 (30%)
Tryp_SPc 30..252 CDD:238113 72/242 (30%)
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 72/241 (30%)
Tryp_SPc 33..271 CDD:238113 72/242 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.