DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and CG11664

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster


Alignment Length:220 Identity:55/220 - (25%)
Similarity:92/220 - (41%) Gaps:36/220 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 GAIIDERWIITAAHCTRGRQATAFRVLTGTQDLH-QNGSKYYYPD-------RIVEHSNYAPRKY 115
            |::...|:::|.|||        |:..|..::|. :.|.::...:       .::.|..::|...
  Fly    49 GSLFSARYVLTVAHC--------FKKNTKPEELSVRAGYRWIAWEFRGKQVAGLLRHPKFSPLTL 105

  Fly   116 RNDIALLHLNESIVFDNATQPVELDHEALVPGSRLL----LTGWGTLSLGGDVPARLQSLEVNYV 176
            |||||:|.:..:|...:....:.|....|.|.:...    |.||..:    .:...|:|:.|...
  Fly   106 RNDIAVLRVKAAISHSHMINYIGLCSRPLTPLNMFAPPQELAGWNLM----HIAQPLKSMSVQVE 166

  Fly   177 PFEQCRAAHDNSTRVDIGHVCTFNDKGRGACHGDSGGPLVHNGKLVALVNWGLPCA-KGYPDAHA 240
            |.:.||...   .::..|.:|.....|.|.|:||||.||:..|::..|......|. |.||....
  Fly   167 PEKNCRQWF---PQISGGVICASATMGEGLCYGDSGDPLISGGEVCGLAIAFRKCGDKRYPALFT 228

  Fly   241 SISYYHDFI--------RTHLSLSK 257
            .:.|:..||        |..||.|:
  Fly   229 DVHYHRAFIAQAVLTLDREMLSKSR 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 49/202 (24%)
Tryp_SPc 30..252 CDD:238113 52/213 (24%)
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 51/204 (25%)
Tryp_SPc 38..237 CDD:214473 49/202 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.