DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and Elane

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001100237.1 Gene:Elane / 299606 RGDID:1307968 Length:271 Species:Rattus norvegicus


Alignment Length:262 Identity:85/262 - (32%)
Similarity:124/262 - (47%) Gaps:39/262 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ILLPLVLFTSSAASQILYPPQYTKNRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIIDERWII 68
            :||.|:|...:.||:           ||||..|.....|:.:|||  ..|.|.||..:|...:::
  Rat    18 MLLALLLVCPALASE-----------IVGGRPAQPHAWPFMVSLQ--RRGGHFCGATLIARNFVM 69

  Fly    69 TAAHCTRGRQATAFRVLTGTQDLHQN--GSKYYYPDRIVEHSNYAPRKYRNDIALLHLNESIVFD 131
            :||||..||...:.:|:.|..||.:.  ..:.:...||.| :.:.|.:..|||.::.||.|...:
  Rat    70 SAAHCVNGRNFQSVQVVLGAHDLRRREPTRQIFSVQRIFE-NGFDPSRLLNDIVIIQLNGSATIN 133

  Fly   132 NATQPVELDHEALVPGSR--LLLTGWGTLSLGGDVPARLQSLEVNYVPFEQCRAAHDNSTRVDIG 194
            ...|..||..:....|:|  .:..|||.|.....:|:.||.|.|..|. ..||      .||   
  Rat   134 ANVQVAELPAQGQGVGNRTPCVAMGWGRLGTNRPLPSVLQELNVTVVT-NLCR------RRV--- 188

  Fly   195 HVCTFNDKGR-GACHGDSGGPLVHNGKLVAL---VNWGLPCAKG-YPDAHASISYYHDF----IR 250
            :|||...:.: |.|.||||||||.|..:..:   :..|  |..| ||||.|.::.:.|:    ||
  Rat   189 NVCTLVPRRQAGICFGDSGGPLVCNNLVQGIDSFIRGG--CGSGFYPDAFAPVAEFADWINSIIR 251

  Fly   251 TH 252
            :|
  Rat   252 SH 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 76/232 (33%)
Tryp_SPc 30..252 CDD:238113 78/234 (33%)
ElaneNP_001100237.1 Tryp_SPc 32..246 CDD:214473 76/239 (32%)
Tryp_SPc 33..249 CDD:238113 76/230 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.