DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and Klk10

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001004100.1 Gene:Klk10 / 292850 RGDID:1303242 Length:279 Species:Rattus norvegicus


Alignment Length:277 Identity:76/277 - (27%)
Similarity:124/277 - (44%) Gaps:47/277 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLILLPLVLFTSSAASQILYPPQYTKNRIVGGEEAAAGLA-----PYQISLQGIGSGAHS---- 56
            ::.:||||::....||..:|.|...|:..:    ||...|.     |:|:||      .|:    
  Rat    17 LVKLLLPLLMMQLWAAQALLLPGNTTREDL----EAFGTLCPSVSQPWQVSL------FHNLQFQ 71

  Fly    57 CGGAIIDERWIITAAHCTRGRQATAFRV------LTGTQDLHQNGSKYYYPDRIVEHSNYAP--- 112
            |.|.::|:.|::|||||.|.:...| ||      |..::.|....|..::|       .|.|   
  Rat    72 CAGVLVDQNWVLTAAHCWRNKPLRA-RVGDDHLLLFQSEQLRSTNSPVFHP-------KYQPCSG 128

  Fly   113 -----RKYRNDIALLHLNESIVFDNATQPVELDHEALVPGSRLLLTGWGTLSLGGDVPAR-LQSL 171
                 |...:|:.:|.|:..:|..:...||:|..:...|.....::||||.:.......| |...
  Rat   129 PVLPLRSDEHDLMMLKLSSPVVLTSKVHPVQLPFQCAQPRQECQVSGWGTTANRRVKYNRSLSCS 193

  Fly   172 EVNYVPFEQCRAAHDNSTRVDIGHVCTFNDKGRGACHGDSGGPLVHNGKLVALVNWGL-PC--AK 233
            .|..:..:||...:...  :....:|...|:.:.:|..|||||||.:..|..:::|.: ||  |.
  Rat   194 RVTLLSQKQCETFYPGV--ITNNMICAGMDRDQDSCQSDSGGPLVCDNTLHGILSWSIYPCGAAT 256

  Fly   234 GYPDAHASISYYHDFIR 250
            .||..:|.|..|.::||
  Rat   257 QYPAVYAKICNYTNWIR 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 65/246 (26%)
Tryp_SPc 30..252 CDD:238113 67/248 (27%)
Klk10NP_001004100.1 Tryp_SPc 50..272 CDD:214473 63/237 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.