DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and Prss34

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:250 Identity:70/250 - (28%)
Similarity:116/250 - (46%) Gaps:33/250 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 IVGGEEAAAGLAPYQISLQ----GIGSGAHSCGGAIIDERWIITAAHCT--RGRQATAFRVLTGT 88
            ||||...:|...|:|:||:    .:....|.|||::|..:|::|||||.  :..:|:.|||..|.
  Rat    33 IVGGCPVSASRFPWQVSLRFYNMKLSKWEHICGGSLIHPQWVLTAAHCVELKEMEASCFRVQVGQ 97

  Fly    89 QDLHQNGSKYYYPDRIVEHSNYAPRKYR---NDIALLHLNESIVFDNATQPVELDHEALVPGSRL 150
            ..|::| .:.....:|:.|..::.:...   .|||||.|:.::|......||.|...:....|:.
  Rat    98 LRLYEN-DQLMKVAKIIRHPKFSEKLSAPGGADIALLKLDSTVVLSERVHPVSLPAASQRISSKK 161

  Fly   151 L--LTGWGTLSLGGDV--PARLQSLEVNYVPFEQCRAAH------DNSTRVDIGHVCTFNDKGRG 205
            .  :.|||.:.....:  |..|:.:.|..|....|...:      |.:|::....:.....:||.
  Rat   162 TWWVAGWGVIEGHRPLPPPCHLREVAVPIVGNSDCEQKYRTYSSLDRTTKIIKDDMLCAGMEGRD 226

  Fly   206 ACHGDSGGPLVHNGKL----VALVNWGLPCAKGYPD-------AHASISYYHDFI 249
            :|..|||||||.....    |.:|:||:.|  |.||       ..:.:|:.|.::
  Rat   227 SCQADSGGPLVCRWNCSWVQVGVVSWGIGC--GLPDFPGVYTRVMSYLSWIHGYV 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 70/248 (28%)
Tryp_SPc 30..252 CDD:238113 70/249 (28%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 69/245 (28%)
Tryp_SPc 33..275 CDD:214473 69/244 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.