DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and CG18420

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster


Alignment Length:280 Identity:73/280 - (26%)
Similarity:115/280 - (41%) Gaps:52/280 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLILLPLVLFTSSAASQILYPPQYTKN------RIVGGEEAAAGLAPYQISLQGIGSGAHSCGG 59
            |..|||.|.:|....::|.|.....|::      |||.|:.|....:|:...|. ..|....|||
  Fly     8 MASILLLLTVFPLLGSTQFLDSECGTRSPLKLGPRIVNGKVAVRNSSPWMAFLH-TSSNQFICGG 71

  Fly    60 AIIDERWIITAAHCTRGRQATAFRV------LTGTQDLHQNGSKYYYPDRIVEHSNYAPRKYRND 118
            .:|..|.::|||||.........|:      |.|.::.||       .:|..:|..|.|..:.||
  Fly    72 TLISRRLVLTAAHCFIPNTTIVVRLGEYNRKLKGYREEHQ-------VNRTFQHRFYDPNTHAND 129

  Fly   119 IALLHLNESIVFDNATQPV----------ELDHEALVPGSRLLLTGWGTLSLGGDVPARLQSLEV 173
            ||||.|..::|:....:|:          .:|...::.|     ||||......| .:.|::|::
  Fly   130 IALLRLVSNVVYKANIRPICIMWDASWKHHIDSIKVLTG-----TGWGRTESMHD-SSELRTLDI 188

  Fly   174 NYVPFEQCRAAHDNSTRVDIGHVCTFNDKGRGACHGDSGGP---LVHNGKLVALVNWGLP----- 230
            :..|.:.|......|.:...|:   :|.   ..|.||:|||   :|........|..|:.     
  Fly   189 SRQPSKMCAFGSVLSNQFCAGN---WNS---NLCIGDTGGPVGAMVRYRNAFRFVQVGIAITNKR 247

  Fly   231 CAKGYPDAHASISYYHDFIR 250
            |.:  |.....:..:.:|||
  Fly   248 CQR--PSVFTDVMSHIEFIR 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 61/243 (25%)
Tryp_SPc 30..252 CDD:238113 63/245 (26%)
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 61/243 (25%)
Tryp_SPc 43..267 CDD:238113 63/245 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437300
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.