DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and CG33461

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster


Alignment Length:260 Identity:64/260 - (24%)
Similarity:101/260 - (38%) Gaps:65/260 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RIVGGEEAAAGLAPYQISLQGIGSGAHS-----CGGAIIDERWIITAAHCTRGRQATAFRVLTGT 88
            :|:.|..|..|..|:...|       |:     |.|::|::.:::|:|||.........|:....
  Fly    41 KIINGTPARLGRYPWMAFL-------HTPTYFLCAGSLINQWFVLTSAHCIEDDVELIARLGENN 98

  Fly    89 Q----DLHQN----GSKYYYPDRIVEHSNYAPRKYRNDIALLHLNESIVFDNATQPVELDHEALV 145
            :    |...|    .::.|..|.:.:|..|.|:.:.|||.:|.|...:.:....||:.:.|.   
  Fly    99 RDNDIDCENNRCLEATQEYNVDMLFKHRLYDPKDFSNDIGMLRLERRVEYTYHIQPICIFHH--- 160

  Fly   146 PGSRLLL----------TGWGTLSLGGDVPARLQSLEVNYV--PFEQC-RAAHDNSTRVDIGHVC 197
              .|:.|          ||||..|...:..:....:|:|..  |...| |....|...   |.:|
  Fly   161 --RRMQLVVDQITWFKATGWGLTSTDLNTKSSRVLMELNLYRRPRNDCARIFKQNFLS---GQIC 220

  Fly   198 TFNDKGRGACHGDSGGPLVHNGKLVAL------VNWGLP------CAKGYPDAHASISYYHDFIR 250
            ..||.| ..|.||||||   .|:.|.:      |..|:.      |:|        :|...|.:|
  Fly   221 AGNDDG-NLCRGDSGGP---QGRYVLIFGMKRFVQMGIASFTYENCSK--------VSILTDVVR 273

  Fly   251  250
              Fly   274  273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 63/257 (25%)
Tryp_SPc 30..252 CDD:238113 64/259 (25%)
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 64/260 (25%)
Tryp_SPc 42..281 CDD:238113 64/259 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437348
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.