DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and CG30323

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_725729.2 Gene:CG30323 / 246539 FlyBaseID:FBgn0050323 Length:306 Species:Drosophila melanogaster


Alignment Length:204 Identity:39/204 - (19%)
Similarity:72/204 - (35%) Gaps:60/204 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 HSCGGAIIDERWIITAAHCTRGRQATAFRVLTGTQDLHQNGSK--YYYPDRIVEHSNYAPRKYRN 117
            |.|.|:::...|::|:..|...|..:     |..|..::...:  .:.|.|:.:.|   |:...:
  Fly    52 HFCAGSLLSAWWVVTSGCCVSTRPES-----TPNQPSNRKNLRVVVFTPKRLKKPS---PKNIYH 108

  Fly   118 DIALLHLNESIVFDNATQPVELDHEALVPGSRLLL---------------TGWGTL--------- 158
             :..:.|:||.: ...|:...|..:..|.|.|..:               .|||.:         
  Fly   109 -VQKIVLDESAI-SGCTELALLKLDRGVTGQRFAMMLPEKELNSTWLCNSLGWGRIYYVSYVYIS 171

  Fly   159 ------SLGGDVP----------ARLQSLEVNYVPFEQCRAAHDNSTRVDIGHVCTFNDKGRG-A 206
                  |:..|.|          :.|..:....:...:|:   .:.:|.    :|..:..||| .
  Fly   172 AMCPAFSMVYDNPVTWFQDGPYSSELIQIRAQKISEYECK---PDCSRC----LCMTSYTGRGNM 229

  Fly   207 CHGDSGGPL 215
            |..|.|.||
  Fly   230 CQQDLGSPL 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 39/204 (19%)
Tryp_SPc 30..252 CDD:238113 39/204 (19%)
CG30323NP_725729.2 Tryp_SPc 45..275 CDD:304450 39/204 (19%)
Tryp_SPc 45..272 CDD:214473 39/204 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436947
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.