DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and CG30187

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:204 Identity:60/204 - (29%)
Similarity:97/204 - (47%) Gaps:31/204 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RIVGGEEAAAGLAPYQIS--LQGIGSGAH-SCGGAIIDERWIITAAHCTRGRQATAFRVLTGTQD 90
            :|.||..||     :|.|  :..:.:..| .|||.:|.:|:::|||||...:...:  |..|.. 
  Fly    35 KITGGHNAA-----FQNSVWMAAVHNRTHFICGGTLIHKRFVLTAAHCIVDQDVQS--VSLGAY- 91

  Fly    91 LHQNGSKYYYPDR-----IVEHSNYAPR-KYRNDIALLHLNESIVFDNATQPVELD-HEALVPGS 148
                 :|....||     .|.||::..| .|.|||.||.|:..::|:...:|:.:. ::::....
  Fly    92 -----NKSDPADRKDVITAVVHSSFDVRASYENDIGLLKLSSDVIFNALIRPICIVLNKSMANHM 151

  Fly   149 RLLLT----GWGTLSLGGDVPARLQSLEVNYVPFEQCRAAHDNSTRVDIGHVCTFNDKGRGACHG 209
            |.:.|    |||||. |......||::.:|::..|:|..  :.|.......:|.....| ..|.|
  Fly   152 RNMRTFKAFGWGTLR-GNKTSDILQTIILNHLDREECYM--ELSVYPSEKQICAGVPSG-DTCGG 212

  Fly   210 DSGGPLVHN 218
            ||||||.::
  Fly   213 DSGGPLTND 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 60/204 (29%)
Tryp_SPc 30..252 CDD:238113 60/203 (30%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 60/204 (29%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.