DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and CG30098

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster


Alignment Length:276 Identity:80/276 - (28%)
Similarity:123/276 - (44%) Gaps:46/276 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLILLPLVLFTSSAASQILYPP--QYTKNRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIID 63
            :||..|.::...|...||:|...  ...:.|::||:.|..  .|:...|  |.....:|||::|.
  Fly     6 VLLTFLVILTLGSYGYSQLLDSKCIALFRIRVIGGQNARR--TPWMAYL--IRDNRFACGGSLIA 66

  Fly    64 ERWIITAAHCTRGRQATAFRVLTGTQDLHQ---NGSKYYYPDRIVEHSNYAPRKYRN-DIALLHL 124
            .|:::||||||:.......|:  |..|..:   ..::.|....|..|.||.  .:|| |||:|.|
  Fly    67 YRFVLTAAHCTKINDNLFVRL--GEYDSSRTTDGQTRSYRVVSIYRHKNYI--DFRNHDIAVLKL 127

  Fly   125 NESIVFDNATQPVELDHEALVPGSRLL--------LTGWGTLSLGGDVPARLQSLEVNYVPFEQC 181
            :..:|:|...:|:.:   .|..|.:.|        |||||.::....:|..||.:.:..|..|.|
  Fly   128 DRQVVYDAYIRPICI---LLNSGLQSLANSIQNFTLTGWGQMAHYYKMPTTLQEMSLRRVRNEYC 189

  Fly   182 RAAHDNSTRVDIGHVCTFNDKGRGACHGDSGGP---LVHNGKLVALVNWGLP-CAKGYPDAHAS- 241
                    .|....:|.:|.. :.||.||||||   ||..|.....|.:|:. ...|..|.::| 
  Fly   190 --------GVPSLSICCWNPV-QYACFGDSGGPLGSLVKYGHKTIYVQFGVTNSVTGNCDGYSSY 245

  Fly   242 ---ISY----YHDFIR 250
               :||    |...:|
  Fly   246 LDLMSYMPWLYQTLLR 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 72/243 (30%)
Tryp_SPc 30..252 CDD:238113 72/245 (29%)
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 71/237 (30%)
Tryp_SPc 37..258 CDD:238113 71/240 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437396
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.