DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and CG30091

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster


Alignment Length:274 Identity:71/274 - (25%)
Similarity:122/274 - (44%) Gaps:33/274 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LILLPLVLFTSSAASQILYP----PQYTKNRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIID 63
            ::|...:|.....::::|..    |.....:||||.:|.....|:...::  .:....|||::|.
  Fly     6 VVLFAWMLTAGRGSARLLDEDCGVPMQLIPKIVGGVDAGELKNPWMALIK--TNDEFICGGSVIT 68

  Fly    64 ERWIITAAHCTRGRQA-----TAFRVLTGTQDL-----HQNGSKYYYPDRIVEHSNYAPRKYRND 118
            .::::|||||....:.     |...|..|...|     |.:..:.|..:|:..|.::|.:.||||
  Fly    69 NKFVLTAAHCMCTDEECIVKYTQLTVTLGVYHLLATGEHNHPHEIYNVERVYIHDSFAIQNYRND 133

  Fly   119 IALLHLNESIVFDNATQPV-ELDHEALVPGSRLL----LTGWGTLSLGGDVPARLQSLEVNYVPF 178
            ||||.|.:|||:....:|: .|.::.|.|.:.|:    ..|||... .|.:...||.:::..:..
  Fly   134 IALLRLQKSIVYKPQIKPLCILLNDQLKPQTDLIQEFTAIGWGVTG-NGKMSNNLQMVKIYRIDR 197

  Fly   179 EQCRAAHDNSTRVDIGHVCTFNDKGRGACHGDSGGPL--------VHNGKLVALVNWGLPCAKGY 235
            :.|.||...:  .|....|.....||..|..||||||        :.....:.:|:.|....:|:
  Fly   198 KMCEAAFWYT--FDYPMFCAGTAVGRDTCKRDSGGPLYIHMLFDGIKRATQLGIVSTGTEDCRGF 260

  Fly   236 PDAHASISYYHDFI 249
             ..:..:..:.|||
  Fly   261 -GMYTDVMGHIDFI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 65/242 (27%)
Tryp_SPc 30..252 CDD:238113 67/243 (28%)
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 65/242 (27%)
Tryp_SPc 37..276 CDD:238113 67/243 (28%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437354
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.