DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and CG30088

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster


Alignment Length:235 Identity:71/235 - (30%)
Similarity:94/235 - (40%) Gaps:47/235 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VLFTSSAASQILYPP---QYTKN---RIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIIDERWI 67
            ::.....|:..|.|.   .|..|   |||.|:||....||:...|. ..|..| |||.||..|:|
  Fly    18 LVLQEQVAANFLIPSCGVSYESNVATRIVRGKEAMLKSAPFMAYLY-YSSEIH-CGGTIISSRYI 80

  Fly    68 ITAAHCTRGRQATAFRVLTGTQDLHQN-------------------GSKYYYPDRIVEHSNYAPR 113
            :|||||.|    ...:|..|..|:.:|                   .:||...||.:        
  Fly    81 LTAAHCMR----PYLKVRLGEHDITRNPDCQGGSCSPPAEEFDIVLATKYKRFDRFL-------- 133

  Fly   114 KYRNDIALLHLNESIVFDNATQPVELD-HEALVPG-SRLLLTGWGTLSLGGDVPARLQSLEVNYV 176
              .||||||.|:.:|.|:...||:.|. :.|..|. ......|||.......... ||:..:...
  Fly   134 --ANDIALLKLSRNIRFNVHIQPICLILNPAAAPNVHEFQAFGWGQTETNHSANV-LQTTVLTRY 195

  Fly   177 PFEQCRAAHDNSTRVDIGHVCTFNDKGRGACHGDSGGPLV 216
            ....||:.  .|..:.|..:|. ..:|...|.||||||||
  Fly   196 DNRHCRSV--LSMPITINQLCV-GFQGSDTCSGDSGGPLV 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 66/209 (32%)
Tryp_SPc 30..252 CDD:238113 65/208 (31%)
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 66/209 (32%)
Tryp_SPc 45..273 CDD:238113 65/208 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437324
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.