DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and svh-1

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_501379.2 Gene:svh-1 / 182375 WormBaseID:WBGene00006620 Length:951 Species:Caenorhabditis elegans


Alignment Length:234 Identity:68/234 - (29%)
Similarity:115/234 - (49%) Gaps:16/234 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIIDERWIITAAHC-TRGRQATAFRVLTGTQDLH 92
            |:|||.|...|..|:..:|:...:.||.||.:|:|:..:|||||| ....:.:::.|:.|..|.:
 Worm   712 RVVGGFETVPGAFPWTAALRNKATKAHHCGASILDKTHLITAAHCFEEDERVSSYEVVVGDWDNN 776

  Fly    93 Q--NGSKYYYPDRIVEHSNYAPRKYRNDIALLHL-NESIVFDNATQPVELDHEALV--PGSRLLL 152
            |  ...:.:|..||..:..|.. .:.:|||:|.: ...|.|:...||:.|..:..|  ||.:.::
 Worm   777 QTDGNEQIFYLQRIHFYPLYKD-IFSHDIAILEIPYPGIEFNEYAQPICLPSKDFVYTPGRQCVV 840

  Fly   153 TGWGTLSLGGDVPARLQSLEVNYVPFEQCRAAHDNSTRVDIGHVCT-FNDKGRGACHGDSGGPLV 216
            :|||  |:|.....|||:..:..:....|..:....:.:.....|. :.:.|..:|.||||||..
 Worm   841 SGWG--SMGLRYAERLQAALIPIINRFDCVNSSQIYSSMSRSAFCAGYLEGGIDSCQGDSGGPFA 903

  Fly   217 ---HNGK--LVALVNWGLPCA-KGYPDAHASISYYHDFI 249
               .:|.  |..:::||..|| |..|..:..::.|..:|
 Worm   904 CRREDGAFVLAGVISWGDGCAQKKQPGIYTMVAPYLSWI 942

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 67/232 (29%)
Tryp_SPc 30..252 CDD:238113 67/233 (29%)
svh-1NP_501379.2 KR 227..306 CDD:214527
LDLa 320..355 CDD:238060
PAN_AP_HGF 373..434 CDD:238532
LDLa 558..590 CDD:197566
SRCR_2 599..681 CDD:382996
Tryp_SPc 713..945 CDD:238113 67/233 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.