DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and Egfbp2

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_034245.3 Gene:Egfbp2 / 13647 MGIID:95292 Length:261 Species:Mus musculus


Alignment Length:272 Identity:72/272 - (26%)
Similarity:119/272 - (43%) Gaps:44/272 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LLILLPLVLFTSSAASQILYPPQYTKNRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIIDERW 66
            |::.|.|.|....||     ||  .::|:|||........|:|:::  .....|.|||.::|..|
Mouse     4 LILFLALSLGGIDAA-----PP--LQSRVVGGFNCKKNSQPWQVAV--YYQKEHICGGVLLDRNW 59

  Fly    67 IITAAHCTRGRQATAFRVLTGTQDLHQNGSKYYYPDRIVEHSNYAP---------------RKYR 116
            ::|||||    ....:.|..|...|.|......:  |:|..|...|               ..:.
Mouse    60 VLTAAHC----YVDQYEVWLGKNKLFQEEPSAQH--RLVSKSFPHPGFNMSLLMLQTIPPGADFS 118

  Fly   117 NDIALLHLNESIVFDNATQPVELDHEALVPGSRLLLTGWGTLSLGGDVPAR------LQSLEVNY 175
            ||:.||.|::.....:..:|:.|..:...|||:.|.:|||:::     |.|      ||.:.:..
Mouse   119 NDLMLLRLSKPADITDVVKPIALPTKEPKPGSKCLASGWGSIT-----PTRWQKPDDLQCVFITL 178

  Fly   176 VPFEQCRAAHDNSTRVDIGHVCTFNDKGRGACHGDSGGPLVHNGKLVALVNWG-LPCAK-GYPDA 238
            :|.|.|...:.... .|:.........|:..|..||||||:.:|.|....::| :||.| |.|..
Mouse   179 LPNENCAKVYLQKV-TDVMLCAGEMGGGKDTCRDDSGGPLICDGILQGTTSYGPVPCGKPGVPAI 242

  Fly   239 HASISYYHDFIR 250
            :.::..::.:|:
Mouse   243 YTNLIKFNSWIK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 63/242 (26%)
Tryp_SPc 30..252 CDD:238113 63/244 (26%)
Egfbp2NP_034245.3 Tryp_SPc 24..253 CDD:214473 63/242 (26%)
Tryp_SPc 25..256 CDD:238113 63/244 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.