DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and CG43110

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster


Alignment Length:251 Identity:71/251 - (28%)
Similarity:111/251 - (44%) Gaps:38/251 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RIVGGEEAAAGLAPYQISLQGIGSGAH-SCGGAIIDERWIITAAHCTRGRQATAFRVLTGTQDLH 92
            :|:.|..|:...|.|   :.||.:..| .|||.||.|.:::|.|||   :......|..|..:::
  Fly    35 KIISGSNASQQSAQY---MAGIFNTTHLLCGGTIIHEDFVLTVAHC---KSTQTLFVRLGAYNIN 93

  Fly    93 QNGSKYYYPDRIVE---HSNYAPRKYRNDIALLHLNESIVFDNATQPVELDHEALVPGSRLL--- 151
            ....:.    |::|   |..|:...|.|||||:.|..|::|:...||:.:..:|.: |.::.   
  Fly    94 HPTDQI----RVIETIAHPQYSNSTYANDIALVKLERSVIFNLNIQPICIHLDATL-GKQIRYYN 153

  Fly   152 LTGWGTLSLGGDVPARLQSLEVNYVPFEQCRAAHDNSTRVDIGHVCTFNDKGRGACHGDSGGPLV 216
            ..|||. :...:....||.:.||......|......|.  |...:|...|:| ..|.|||||||:
  Fly   154 AFGWGR-TRNAEQSDILQRIFVNRTNPMICHLYLGMSP--DPKQICATTDQG-DTCAGDSGGPLI 214

  Fly   217 ----HNGK----LVALVNWGLPCAKG---YPDAHASISYYHDFIRTHLSLSKTDSS 261
                :.||    ...:.::|.....|   |.|    :|.|..:| .::..||.|.|
  Fly   215 SKITYQGKNFDTQFGITSYGTRECNGVGLYTD----VSQYSGWI-ANIVRSKQDRS 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 66/237 (28%)
Tryp_SPc 30..252 CDD:238113 67/239 (28%)
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 66/237 (28%)
Tryp_SPc 36..257 CDD:238113 67/240 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437384
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.