DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and CG43124

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001247345.1 Gene:CG43124 / 12798282 FlyBaseID:FBgn0262587 Length:245 Species:Drosophila melanogaster


Alignment Length:276 Identity:53/276 - (19%)
Similarity:101/276 - (36%) Gaps:51/276 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ILLPLVLFTSSAASQILYPPQYTKNRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIIDERWII 68
            |:|.:||.....::|.|..........:.|...|..||      :.:......|.||:|:..:::
  Fly     7 IVLCIVLMFYQGSAQTLEEDCVDHMERINGSSYAPWLA------EILSDSKVICAGALINNLYVL 65

  Fly    69 TAAHCTRGRQATAFRVLTGTQDLHQNGSKYYYPDRIVE---HSNYAPRKYRNDIALLHLNESIVF 130
            |||.|.:..:....|:.:|..|      |.|...|:.:   ...:.|....|::.:..|...:.|
  Fly    66 TAASCFKENEKLTVRLGSGYFD------KSYENFRVTKAYFWMTHFPANNTNNLCIFRLQTEVEF 124

  Fly   131 DNATQPVELDHEALVPGSRLLLTGWGTLSLGGDVP------ARLQSLEVNYVPFEQCRAAHDNST 189
            ....:|:.:...   |.|..|.|   |..:..:.|      ..::.|...||..|.         
  Fly   125 KTHIRPMCITKS---PKSLGLAT---TFEIINEKPKMWYFCKNIKGLFCKYVFGEN--------- 174

  Fly   190 RVDIGHVCTFNDKGRGACHGDSGGPLVHNGKLVALVNWGLPC---AKGYPDAHASISYYHDFIRT 251
                      .:|.:....|......:.||....||.:|:..   .|.|.:.:.::..:.::| .
  Fly   175 ----------EEKWQSKPTGSPWTETISNGPFKGLVRYGILSYRDNKTYDEVYINVMSHINWI-A 228

  Fly   252 HLSLSKTDSSEDIEEE 267
            .:|| :.|.|..::::
  Fly   229 QISL-EIDISTPVKKK 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 42/231 (18%)
Tryp_SPc 30..252 CDD:238113 43/233 (18%)
CG43124NP_001247345.1 Tryp_SPc 41..>133 CDD:304450 21/103 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.