DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and LOC1276351

DIOPT Version :10

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_315688.2 Gene:LOC1276351 / 1276351 VectorBaseID:AGAMI1_007702 Length:300 Species:Anopheles gambiae


Alignment Length:152 Identity:34/152 - (22%)
Similarity:58/152 - (38%) Gaps:29/152 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 PQSGVSILKQLKILSLPDNLIEYVQDNAFLSYHSRDSLLKLDLSAN--NLTAIHP-TGLLGLENL 185
            |.|...:||.|.:|.   .|.........|:.|....|.| ||...  ....:.| |.|.|:   
Mosquito     3 PASNTIVLKSLSVLL---GLFFIFVGTLKLTPHISKDLYK-DLRTEYVKYAKVFPLTALFGV--- 60

  Fly   186 SQLSLDKNLLSEIPSQALENIPSLED----LSLGVNRIHTISRNSLPLPNLKSLSLEVNQIRLIP 246
                       :|||:.......:.:    |::.:...|.: :|:..:..|..:.|.:.|..:: 
Mosquito    61 -----------KIPSKWYRRTVGILEIVCGLAMALIPYHKV-KNTANVTLLVLMLLGIYQHWMV- 112

  Fly   247 SDSFSET-PLLSYLY-LGNNLL 266
            ||.|..: |.|.:.: ||..|:
Mosquito   113 SDPFERSGPALVFTFMLGGRLV 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 27/131 (21%)
LOC1276351XP_315688.2 None

Return to query results.
Submit another query.