DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and KLK11

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_011524671.1 Gene:KLK11 / 11012 HGNCID:6359 Length:307 Species:Homo sapiens


Alignment Length:285 Identity:73/285 - (25%)
Similarity:119/285 - (41%) Gaps:54/285 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LLILLPLVLFTSSAASQILYPPQYTKNRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIIDERW 66
            :|.|:.|.|.|.....:         .||:.|.|......|:|.:|  .......||..:|..||
Human    35 ILQLILLALATGLVGGE---------TRIIKGFECKPHSQPWQAAL--FEKTRLLCGATLIAPRW 88

  Fly    67 IITAAHCTRGRQATAFRVLTG----TQDLHQNGSKYYYPDRIVEH-------------------- 107
            ::|||||.:     .:..||.    :.||..:.....:..|.:.|                    
Human    89 LLTAAHCLK-----PWVSLTSPTHVSPDLSSSNYCLSHLSRYIVHLGQHNLQKEEGCEQTRTATE 148

  Fly   108 -------SNYAPRK-YRNDIALLHLNESIVFDNATQPVELDHEALVPGSRLLLTGWG-TLSLGGD 163
                   :|..|.| :||||.|:.:...:....|.:|:.|....:..|:..|::||| |.|....
Human   149 SFPHPGFNNSLPNKDHRNDIMLVKMASPVSITWAVRPLTLSSRCVTAGTSCLISGWGSTSSPQLR 213

  Fly   164 VPARLQSLEVNYVPFEQCRAAHDNSTRVDIGHVC-TFNDKGRGACHGDSGGPLVHNGKLVALVNW 227
            :|..|:...:..:..::|..|:..:  :....|| :..:.|:.:|.||||||||.|..|..:::|
Human   214 LPHTLRCANITIIEHQKCENAYPGN--ITDTMVCASVQEGGKDSCQGDSGGPLVCNQSLQGIISW 276

  Fly   228 GL-PCA-KGYPDAHASISYYHDFIR 250
            |. ||| ...|..:..:..|.|:|:
Human   277 GQDPCAITRKPGVYTKVCKYVDWIQ 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 67/255 (26%)
Tryp_SPc 30..252 CDD:238113 67/257 (26%)
KLK11XP_011524671.1 Tryp_SPc 53..300 CDD:214473 67/255 (26%)
Tryp_SPc 54..303 CDD:238113 67/257 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.