DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and Try5

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001003405.1 Gene:Try5 / 103964 MGIID:102756 Length:246 Species:Mus musculus


Alignment Length:247 Identity:78/247 - (31%)
Similarity:132/247 - (53%) Gaps:15/247 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VLFTSSAASQILYPPQYTKNRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIIDERWIITAAHC 73
            :||.:...:.:.:|.. ..::||||........|||:||   .||.|.|||::|:::|:::||||
Mouse     4 LLFLALVGAAVAFPVD-DDDKIVGGYTCRENSIPYQVSL---NSGYHFCGGSLINDQWVVSAAHC 64

  Fly    74 TRGRQATAFRVLTGTQDLH--QNGSKYYYPDRIVEHSNYAPRKYRNDIALLHLNESIVFDNATQP 136
            .:    |..:|..|..:::  :...::....:|::|.|:..|...|||.|:.|...:..:.....
Mouse    65 YK----TRIQVRLGEHNINVLEGNEQFVNSAKIIKHPNFNSRTLNNDIMLIKLASPVTLNARVAT 125

  Fly   137 VELDHEALVPGSRLLLTGWG-TLSLGGDVPARLQSLEVNYVPFEQCRAAHDNSTRVDIGHVCT-F 199
            |.|.......|::.|::||| |||.|.:.|..||.|:...:|...|.|::..  ::....:|. |
Mouse   126 VALPSSCAPAGTQCLISGWGNTLSFGVNNPDLLQCLDAPLLPQADCEASYPG--KITNNMICVGF 188

  Fly   200 NDKGRGACHGDSGGPLVHNGKLVALVNWGLPCA-KGYPDAHASISYYHDFIR 250
            .:.|:.:|.||||||:|.||:|..:|:||..|| |..|..:..:..|.|:|:
Mouse   189 LEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALKDNPGVYTKVCNYVDWIQ 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 74/224 (33%)
Tryp_SPc 30..252 CDD:238113 75/226 (33%)
Try5NP_001003405.1 Tryp_SPc 23..239 CDD:214473 74/224 (33%)
Tryp_SPc 24..242 CDD:238113 75/226 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S12540
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.