DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and LOC103908930

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001373362.1 Gene:LOC103908930 / 103908930 -ID:- Length:243 Species:Danio rerio


Alignment Length:232 Identity:76/232 - (32%)
Similarity:120/232 - (51%) Gaps:14/232 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 NRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIIDERWIITAAHCTRGRQATAFRVLTGTQ--D 90
            ::|:||.|......|:||.:  ...|...||.::|:|.|.::||||..|  |....|..|..  |
Zfish    19 DKIIGGYECPPNSQPWQIYI--TNDGQRWCGASLINESWAVSAAHCNIG--ANLLTVYLGKHNID 79

  Fly    91 LHQNGSKYYYPDRIVEHSNYAPRKYRNDIALLHLNESIVFDNATQPVELDHEALVPGSRLLLTGW 155
            :.:...:....:::..|..:......|||.|:.|.:..||:...||:.|.......|.:.|::||
Zfish    80 VVEKTEQRIRTEKVFPHPEFKFPSEDNDIMLIKLKDPAVFNQYVQPIPLATSCSSEGEQCLVSGW 144

  Fly   156 GTLSLGGDVPARLQSLEVNYVPFEQC-RAAHDNSTRVDIGHVCT-FNDKGRGACHGDSGGPLVHN 218
            |...:|  :|:.||.|::.....::| |...|..|:   ..:|. |.:.|:|.||||||||||.|
Zfish   145 GYTEVG--LPSVLQCLDLAVQSRQECERVYKDKFTQ---NMLCAGFMEGGKGVCHGDSGGPLVCN 204

  Fly   219 GKLVALVNWGLPCAK-GYPDAHASISYYHDFIRTHLS 254
            |:|..:|:||..||: |||..:..:..|.|:|.|.::
Zfish   205 GELRGVVSWGAGCAEPGYPAVYVEVCRYSDWIATTIA 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 74/224 (33%)
Tryp_SPc 30..252 CDD:238113 75/226 (33%)
LOC103908930NP_001373362.1 Tryp_SPc 21..239 CDD:238113 75/226 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.