DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and Klk9

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_082936.2 Gene:Klk9 / 101533 MGIID:1921082 Length:251 Species:Mus musculus


Alignment Length:265 Identity:72/265 - (27%)
Similarity:119/265 - (44%) Gaps:42/265 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LPLVLFTSSAASQILYPPQYTKNRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIIDERWIITA 70
            |.||||:      :|........|.||..|......|:|..|..:  ....||..:|:::|::||
Mouse     5 LTLVLFS------LLAGHCGADTRAVGARECVRNSQPWQAGLFYL--TRQLCGATLINDQWLLTA 61

  Fly    71 AHCTRGRQATAFRVLTGTQDLHQNGSKYYYPDRIV------EHSNYAP----RKYRNDIALLHLN 125
            |||.:    ....|..|...|.    ::..|::::      .|..:.|    ..:.:||.|:.|.
Mouse    62 AHCRK----PYLWVRLGEHHLW----RWEGPEQLLLVTDFFPHPGFNPDLSANDHNDDIMLIRLP 118

  Fly   126 ESIVFDNATQPVELDHEALVPGSRLLLTGWGTLSLGG-DVPARLQSLEVNYVPFEQCRAAHDNST 189
            ..:....|.||:.|.......|::.|::|||::|... ..|..||...::.:..:.||.|:.   
Mouse   119 RKVRLTPAVQPLNLTESRPPVGTQCLISGWGSVSSSKLQYPMTLQCANISILDNKLCRWAYP--- 180

  Fly   190 RVDIGHV-----CT-FNDKGRGACHGDSGGPLVHNGKLVALVNWGL-PCAK-GYPDAHASISYYH 246
                ||:     |. ..:.|||:|.||||||||..|.|..:|:.|. ||:: ..|..:.::..|.
Mouse   181 ----GHISEKMLCAGLWEGGRGSCQGDSGGPLVCEGTLAGIVSGGSEPCSRPRRPAVYTNVFDYL 241

  Fly   247 DFIRT 251
            ::|.:
Mouse   242 EWIES 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 65/238 (27%)
Tryp_SPc 30..252 CDD:238113 65/241 (27%)
Klk9NP_082936.2 Tryp_SPc 24..247 CDD:238113 65/240 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.