DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and LOC100498532

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001333498.1 Gene:LOC100498532 / 100498532 -ID:- Length:251 Species:Xenopus tropicalis


Alignment Length:255 Identity:79/255 - (30%)
Similarity:133/255 - (52%) Gaps:19/255 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLPL--VLFTSSAASQILYPPQYTKNRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIIDERWI 67
            ::||  ::|.:.||:.   |.....::||||.|......|:|:..  ..:|.:.|||::|..|||
 Frog     1 MMPLWVLMFLAVAAAA---PLDDDDDKIVGGYECTPHSQPWQVLF--TYNGGNWCGGSLISPRWI 60

  Fly    68 ITAAHCTRGRQATAFRVLTGTQDL--HQNGSKYYYPDRIVEHSNYAPRKYRNDIALLHLNESIVF 130
            |:||||.:..:...  .|.|..||  .:...::...:...:|..|..:.:.:||.|:.|.:...:
 Frog    61 ISAAHCYQPPKTLV--ALLGEHDLKKKEGTEQHIQVEAAYKHFGYKDKAHDHDIMLVKLAKPAQY 123

  Fly   131 DNATQPVELDHEALVPGSRLLLTGWGTLSLGGDV--PARLQSLEVNYVPFEQCRAAHDNSTRVDI 193
            :...||:.:.......|::.|::|:|.: ||.:|  |.:||.|||..|....|:|::..  .:..
 Frog   124 NQYVQPIPVARSCPTDGAKCLVSGFGNV-LGYNVRYPDQLQCLEVPIVSDSSCKASYPR--MISE 185

  Fly   194 GHVCT-FNDKGRGACHGDSGGPLVHNGKLVALVNWG--LPCAKGYPDAHASISYYHDFIR 250
            ...|. |.:.|:|:|||||||||:.||:|...|:||  ...:|..|..:|.:..|.|:|:
 Frog   186 NMFCAGFLEGGKGSCHGDSGGPLICNGELYGAVSWGGSYCISKNSPGVYAKVCNYLDWIK 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 72/226 (32%)
Tryp_SPc 30..252 CDD:238113 73/228 (32%)
LOC100498532NP_001333498.1 Tryp_SPc 25..247 CDD:238113 73/228 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.