DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and LOC100485189

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_002941065.2 Gene:LOC100485189 / 100485189 -ID:- Length:249 Species:Xenopus tropicalis


Alignment Length:247 Identity:75/247 - (30%)
Similarity:118/247 - (47%) Gaps:13/247 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VLFTSSAASQILYPPQYTKNRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIIDERWIITAAHC 73
            :||.|:.....:....|  :||:||.|......|:..||.....  |.|||.:|||.|::|||||
 Frog     3 ILFVSALLGTAVQARYY--DRIIGGTECRPNSQPWHCSLYYFDQ--HVCGGVLIDENWVLTAAHC 63

  Fly    74 TRGRQATAFRVLTGTQDL--HQNGSKYYYPDRIVEHSNYAPRKYRNDIALLHLNESIVFDNATQP 136
                |.::.:|..|..:|  ::...::.|.:::..||.:.|..:.|||.||.|...:..::..|.
 Frog    64 ----QLSSLQVRLGEHNLAVYEGKEQFSYAEKMCPHSGFNPITFDNDIMLLKLVSPVTINDYVQT 124

  Fly   137 VELDHEALVPGSRLLLTGWGTLSLGGDV-PARLQSLEVNYVPFEQCRAAHDNSTRVDIGHVCTFN 200
            :.|....:..|...|::||||.:...:. |..||.:||..|..:.|:.|.......|........
 Frog   125 IPLGCPTVGDGETCLVSGWGTTTSPEETFPDELQCVEVQTVSQDYCQGAFPTDEITDNMLCAGVM 189

  Fly   201 DKGRGACHGDSGGPLVHNGKLVALVNWG-LPC-AKGYPDAHASISYYHDFIR 250
            :.|:.:|.||||||||.|..:..:.:|| .|| ....|..:..|..|..:|:
 Frog   190 EGGKDSCQGDSGGPLVCNSMVHGITSWGNTPCGVANKPGIYTKICNYIAWIQ 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 70/224 (31%)
Tryp_SPc 30..252 CDD:238113 70/226 (31%)
LOC100485189XP_002941065.2 Tryp_SPc 22..243 CDD:238113 70/226 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.