DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and proc.2

DIOPT Version :10

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001120289.1 Gene:proc.2 / 100145345 XenbaseID:XB-GENE-5882297 Length:681 Species:Xenopus tropicalis


Alignment Length:76 Identity:22/76 - (28%)
Similarity:30/76 - (39%) Gaps:12/76 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 YSQCPTLQLQEPCTCTSTRYEAVSINCDGGSSL-------DAVLES---LSNSPQAIDSLTISNT 69
            |.|.|.:|:........:|:  |...|....||       |.|||.   |.:.|..:|.|...|.
 Frog   179 YVQRPFIQMSWEKEEGKSRH--VDFQCVRSKSLTNLVAAGDDVLEDQEILMHHPPQVDELDRLNA 241

  Fly    70 PIEKMPGYAFQ 80
            |:.:|....||
 Frog   242 PLSQMASNDFQ 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 18/62 (29%)
proc.2NP_001120289.1 GLA 19..80 CDD:214503
EGF_CA 81..117 CDD:238011
FXa_inhibition 123..160 CDD:464251
Tryp_SPc 436..666 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.