DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5255 and zgc:171509

DIOPT Version :9

Sequence 1:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001307362.1 Gene:zgc:171509 / 100141339 ZFINID:ZDB-GENE-080219-48 Length:240 Species:Danio rerio


Alignment Length:232 Identity:73/232 - (31%)
Similarity:122/232 - (52%) Gaps:27/232 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 NRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIIDERWIITAAHCTRGRQATAFRVLTGTQDLH 92
            ::|:||.|......|:|..|.   .|...|||::|.|.|:::||||    ::::..|..|..||.
Zfish    19 DKIIGGHECQPHSQPWQARLD---DGYGLCGGSLIHESWVVSAAHC----KSSSIIVHLGKHDLF 76

  Fly    93 --QNGSKYYYPDRIVEHSNYAPRKYRNDIALLHLNESIVFDNATQPVELDHEALVPGSRLLLTGW 155
              ::.::....::::.|..|..|::.|||.|:.|.|..|.:|..:||.|.......|.:.|::||
Zfish    77 VVEDTAQEIQAEKVISHPKYNNREHNNDIMLIKLREPAVINNNVKPVPLPTNCSHAGEQCLVSGW 141

  Fly   156 GTLSLGGDVPARLQSLEVNYVPFEQCRAAHDNSTRVDIGHVCT-------FNDKGRGACHGDSGG 213
            |.  .|..:.:.||.||:..:....|::|:        |.|.|       |.|.|:.:|.|||||
Zfish   142 GV--TGDSISSTLQCLELPILSKADCKSAY--------GRVITKKMFCAGFMDGGKDSCQGDSGG 196

  Fly   214 PLVHNGKLVALVNWGLPCAK-GYPDAHASISYYHDFI 249
            |:|.||.|..:|::|:.||: |:|..:..:..|.::|
Zfish   197 PVVCNGTLKGIVSFGIGCAEPGFPGVYVEVCRYINWI 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 72/229 (31%)
Tryp_SPc 30..252 CDD:238113 73/230 (32%)
zgc:171509NP_001307362.1 Tryp_SPc 20..233 CDD:214473 72/229 (31%)
Tryp_SPc 21..234 CDD:238113 73/230 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.