DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and KLK4

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_004908.4 Gene:KLK4 / 9622 HGNCID:6365 Length:254 Species:Homo sapiens


Alignment Length:244 Identity:69/244 - (28%)
Similarity:122/244 - (50%) Gaps:43/244 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 TRVIGGVDSPTGFAPYQVSIMNTFGEHVCGGSIIAPQWILTAAHCMEWPIQYLKIVTGTVDYT-- 102
            :::|.|.|......|:|.:::.. .|..|.|.::.|||:|:||||.:            ..||  
Human    29 SQIINGEDCSPHSQPWQAALVME-NELFCSGVLVHPQWVLSAAHCFQ------------NSYTIG 80

  Fly   103 ----------RPGAEYLVDGSKI--HCSHDKPAYHNDIALIHTAKPIVYDDLTQPIKLASKGSLP 155
                      .||:: :|:.|..  |..:::|...||:.||...:.:...|..:.|.:||:  .|
Human    81 LGLHSLEADQEPGSQ-MVEASLSVRHPEYNRPLLANDLMLIKLDESVSESDTIRSISIASQ--CP 142

  Fly   156 KVGDKLTLTGWGSTKTWGRYSTQLQKIDLNYIDHDNCQSRVRNANWLSEGHVCTFT----QEGEG 216
            ..|:...::|||.... ||..|.||.::::.:..:.| |::.:..:    |...|.    |:.:.
Human   143 TAGNSCLVSGWGLLAN-GRMPTVLQCVNVSVVSEEVC-SKLYDPLY----HPSMFCAGGGQDQKD 201

  Fly   217 SCHGDSGGPLVDANQTLVGVVNWGEA-CA-IGYPDVFGSVAYYHDWIEQ 263
            ||:|||||||: .|..|.|:|::|:| |. :|.|.|:.::..:.:|||:
Human   202 SCNGDSGGPLI-CNGYLQGLVSFGKAPCGQVGVPGVYTNLCKFTEWIEK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 66/239 (28%)
Tryp_SPc 42..263 CDD:238113 68/240 (28%)
KLK4NP_004908.4 Tryp_SPc 31..250 CDD:238113 69/242 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.