DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and Prss55

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_036014741.1 Gene:Prss55 / 71037 MGIID:1918287 Length:347 Species:Mus musculus


Alignment Length:280 Identity:86/280 - (30%)
Similarity:134/280 - (47%) Gaps:32/280 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KCLVLISVLVILSQCSAKSVKIHRRHQLNHHLGHVKPETRVIGGVDSPTGFAPYQVSIMNTFGEH 66
            :||:.|:    .|:|..:.:...|...           :|:|.|.::..|..|:||||..: ..|
Mouse    36 ECLLCIA----SSECGVRPLYDSRIQY-----------SRIIEGQEAELGEFPWQVSIQES-DHH 84

  Fly    67 VCGGSIIAPQWILTAAHC---MEWPIQYLKIVTGTVDYTRPGAEYLVDGSKIHCSHDKPAYHNDI 128
            .|||||::..||||.|||   .|.....|::..||.|.|....|..|.....|....:....|||
Mouse    85 FCGGSILSEWWILTVAHCFYAQELSPTDLRVRVGTNDLTTSPVELEVTTIIRHKGFKRLNMDNDI 149

  Fly   129 ALIHTAKPIVYDDLTQPIKLASKGSLPKVGDKLTLTGWGSTKTWGR--YSTQLQKIDLNYIDHDN 191
            ||:..|||:.:::||.||.| .....|....:..:.|||.|.:..:  .||.|.|:.:..|:.:.
Mouse   150 ALLLLAKPLTFNELTVPICL-PLWPAPPSWHECWVAGWGVTNSTDKESMSTDLMKVPMRIIEWEE 213

  Fly   192 CQSRVRNANWLSEGHVC-TFTQEGEGSCHGDSGGPLV-----DANQTLVGVVNWGEACA-IGYPD 249
            |.....:   |:...:| ::..|...:|.||||||||     .:....||:::||::|. .|:|.
Mouse   214 CLQMFPS---LTTNMLCASYGNESYDACQGDSGGPLVCTTDPGSRWYQVGIISWGKSCGKKGFPG 275

  Fly   250 VFGSVAYYHDWIEQMMTDAG 269
            ::..:|.|..|||::....|
Mouse   276 IYTVLAKYTLWIEKIAQTEG 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 76/231 (33%)
Tryp_SPc 42..263 CDD:238113 77/232 (33%)
Prss55XP_036014741.1 Tryp_SPc 60..287 CDD:214473 76/231 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.