DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and Klk10

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_598473.1 Gene:Klk10 / 69540 MGIID:1916790 Length:278 Species:Mus musculus


Alignment Length:250 Identity:63/250 - (25%)
Similarity:109/250 - (43%) Gaps:40/250 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 TRV---IGGVDSPTGFAPYQVSIMNTFGEHVCGGSIIAPQWILTAAHCMEWPIQYLKIVTGTVDY 101
            |||   ..|......:.|:|||:.:.. :..|.|.::...|:||||||  |..:.|:        
Mouse    42 TRVDLEASGAQCERDYHPWQVSLFHNL-QFQCAGVLVDQNWVLTAAHC--WRNKPLR-------- 95

  Fly   102 TRPGAEYLVDGSKIHC-SHDKPAYH-----------------NDIALIHTAKPIVYDDLTQPIKL 148
            .|.|.::|:...|... |...|.:|                 :|:.::..:.|::......|::|
Mouse    96 ARVGDDHLLLFQKEQLRSTSSPVFHPKYQACSGPILPHRSDEHDLMMLKLSSPVMLTSNVHPVQL 160

  Fly   149 ASKGSLPKVGDKLTLTGWG-STKTWGRYSTQLQKIDLNYIDHDNCQSRVRNANWLSEGHVCTFTQ 212
            ..:.|.|  |.:..::||| |.....:|:..|....:..:....|::.....  ::...:|....
Mouse   161 PFRCSQP--GQECQVSGWGTSASRRVKYNRSLSCSKVTLLSQKQCETFYPGV--ITNSMICAEAD 221

  Fly   213 EGEGSCHGDSGGPLVDANQTLVGVVNWG-EAC-AIGYPDVFGSVAYYHDWIEQMM 265
            ..:.||..||||||| .:.||.||::|| ..| |..:|.|:..:..|..||.:::
Mouse   222 GNQDSCQSDSGGPLV-CDDTLHGVLSWGIYPCGAAQHPSVYSEICKYTPWIRRVI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 60/243 (25%)
Tryp_SPc 42..263 CDD:238113 61/244 (25%)
Klk10NP_598473.1 Tryp_SPc 50..271 CDD:214473 58/236 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.