DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and prss1

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_571783.2 Gene:prss1 / 65223 ZFINID:ZDB-GENE-010131-7 Length:247 Species:Danio rerio


Alignment Length:276 Identity:77/276 - (27%)
Similarity:127/276 - (46%) Gaps:43/276 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKCLVLISVLVILSQCSAKSVKIHRRHQLNHHLGHVKP----ETRVIGGVDSPTGFAPYQVSIMN 61
            ||..:|:::..:                     .:..|    :.:::||.:......|||||:.:
Zfish     1 MKAFILLALFAV---------------------AYAAPLGDDDDKIVGGYECTKNGVPYQVSLNS 44

  Fly    62 TFGEHVCGGSIIAPQWILTAAHCMEWPIQYLKIVTGTVDYTRPGAEYLVDGSKI--HCSHDKPAY 124
              |.|.||||:|:..|:::||||.:..:| :::....:|.|. |.|..::..|:  |.|::....
Zfish    45 --GYHFCGGSLISNLWVVSAAHCYKSRVQ-VRLGEHNIDVTE-GTEQFINSEKVIRHPSYNSNTL 105

  Fly   125 HNDIALIHTAKPIVYDDLTQPIKLASKGSLPKVGDKLTLTGWGSTKTWG-RYSTQLQKIDLNYID 188
            .||:.||..:.....:...:.:.|.|  |....|....::|||:....| .|.::|..::...:.
Zfish   106 DNDVMLIKLSSSAQINSYVKTVSLPS--SCASSGTSCLISGWGNMSASGSNYPSRLMCLNAPILS 168

  Fly   189 HDNCQSRVRNA--NWLSEGHVCT-FTQEGEGSCHGDSGGPLVDANQTLVGVVNWGEACA-IGYPD 249
            ...|    |||  ..:|....|. |.:.|:.||.||||||:|..|| |.|:|:||..|| ...|.
Zfish   169 DSTC----RNAYPGQISSNMFCAGFMEGGKDSCQGDSGGPVVCNNQ-LQGIVSWGYGCAQRNKPG 228

  Fly   250 VFGSVAYYHDWIEQMM 265
            |:..|..:..||...|
Zfish   229 VYAKVCNFTTWIRNTM 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 70/226 (31%)
Tryp_SPc 42..263 CDD:238113 72/227 (32%)
prss1NP_571783.2 Tryp_SPc 24..240 CDD:214473 70/226 (31%)
Tryp_SPc 25..243 CDD:238113 72/228 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.