DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and CG17242

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001259921.1 Gene:CG17242 / 59226 FlyBaseID:FBgn0250841 Length:245 Species:Drosophila melanogaster


Alignment Length:263 Identity:67/263 - (25%)
Similarity:116/263 - (44%) Gaps:42/263 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ISVLVILSQCSA--KSVKIHRRHQLNHHLGHVKPETRVIGGVDSPTGFAPYQVSIMNTFGEHVCG 69
            |.:||.::|.:|  ||:.|.:                           ||:|.|:... .:|.||
  Fly     6 ILLLVSIAQIAADFKSIGIEQ---------------------------APWQASVQIN-DKHHCG 42

  Fly    70 GSIIAPQWILTAAHCM-EWPIQYLKIVTGTVDYTRPGAEYLVDGSKIHCSHDKPAYHNDIALIHT 133
            |.|.:...|||.|.|: :..::::.:..|:......|....|:..::.....:|   :|:|::..
  Fly    43 GVIYSEDIILTIAECVRKARLEFISVRVGSAQENAGGTVLKVEKMRLQVLGLRP---SDVAILQL 104

  Fly   134 AKPIVYDDLTQPIKLASKGSLPKVGDKLTLTGWGSTKTWGRYSTQLQKIDLNYIDHDNCQSRVR- 197
            ..|:..|...:.|.||:...:|  |...:::|||........|..|.::|:...|...|.:.:. 
  Fly   105 RSPLYLDGGIRAIPLATIPLVP--GTNASVSGWGQLSAMNPSSEVLLRVDVKIQDQLMCATNLAL 167

  Fly   198 NANWLSEGHVCTFTQEGE--GSCHGDSGGPLVDANQTLVGVVNWGEAC-AIGYPDVFGSVAYYHD 259
            ....:|.|.:|. ...||  .:|.|..||||| ||..|.|:::|..|| .:....|:.::|.:..
  Fly   168 KGRLMSVGEICA-APAGEIPYACQGFVGGPLV-ANNRLYGILSWQSACDVLNKSSVYANIAMFKV 230

  Fly   260 WIE 262
            |||
  Fly   231 WIE 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 56/224 (25%)
Tryp_SPc 42..263 CDD:238113 59/226 (26%)
CG17242NP_001259921.1 Tryp_SPc 24..235 CDD:238113 60/245 (24%)
Tryp_SPc 24..232 CDD:214473 57/242 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.