DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and CG17234

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster


Alignment Length:241 Identity:85/241 - (35%)
Similarity:120/241 - (49%) Gaps:39/241 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ETRVIGGVDSPTGF--APYQVSIMNTFGEHVCGGSIIAPQWILTAAHCM------EWPIQYLKIV 95
            |.|:|||  .|.|.  .|:||| :..||:|||||||.:...|:|||||.      ....|..::.
  Fly    24 EQRIIGG--EPIGIEQVPWQVS-LQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVR 85

  Fly    96 TGTVDYTRPGAEYLVDGSKIHCSHDKPAYH---NDIALIHTAKPIVYDDLTQPIKLASKGSLPKV 157
            .|:......|.  |||.:.: ..|::.|:.   ||||::..:.|:.:....|||.||.....|: 
  Fly    86 AGSALTDSNGT--LVDVAAL-IIHEEYAFDLNINDIAIVRLSTPLEFTSKVQPIPLAKTNPYPR- 146

  Fly   158 GDKLTLTGWG-------STKTWGRYSTQLQKIDLNYIDHDNCQSRVRNANWLSEGHVCTFTQEGE 215
             ....::|||       ||..   |.|.||.:.|:.....:|  |:.:.:.|..|   |:   |.
  Fly   147 -SIALVSGWGVSYILNDSTNL---YPTHLQGLALHIKSIFSC--RLFDPSLLCAG---TY---GR 199

  Fly   216 GSCHGDSGGPLVDANQTLVGVVNWGEACAIGYPDVFGSVAYYHDWI 261
            .:|||||||||| .|:.|||||:||....:. ...|.||.|:.:||
  Fly   200 TACHGDSGGPLV-VNKQLVGVVSWGRKGCVS-SAFFVSVPYFREWI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 82/237 (35%)
Tryp_SPc 42..263 CDD:238113 83/238 (35%)
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 82/237 (35%)
Tryp_SPc 27..243 CDD:238113 81/236 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.