DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and CG34409

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster


Alignment Length:276 Identity:70/276 - (25%)
Similarity:119/276 - (43%) Gaps:68/276 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VKPETRVIGGVDSPTGFAPY--QVSIMNTFGEHV---CGGSIIAPQWILTAAHCM-----EWPIQ 90
            :..|:|::||..:..|..|:  :::..|.....:   |.||:|:...|:|||||:     :..:.
  Fly   244 INVESRLLGGDQASAGQFPWLTRIAYRNRSSSRISFRCSGSLISSNHIVTAAHCVVNLVSDLELS 308

  Fly    91 YLKIVTGTVDYTRPGAEYLVDGSKIHCSHDKPAYHNDIALIH------TAKPIVYDDLTQPIKLA 149
            ::::  |:.|...|   :.::...:|.::|:|.|.|||||:.      |..||.. ....||.|.
  Fly   309 HVRL--GSQDGATP---FAIEQVIVHPNYDQPKYANDIALLRINSTNGTFTPICL-PFNGPITLG 367

  Fly   150 SKGSLPKVGDKLTLTGW--GSTK----------TWGRYSTQLQKIDLNYIDHDNCQSRVRNANWL 202
            ::    .:|......||  |||:          |.|     ::.|.|..::..:|.....:   |
  Fly   368 NR----LIGQIGVAAGWSIGSTENNSSMDPSNSTAG-----VRFIRLPIVNTTSCAIAYAS---L 420

  Fly   203 SE----------GHVCTFTQEGEGSCHGDSGGPLVD----------ANQTLVGVVNWGEA-CAI- 245
            ||          .|:|.........|.||||||.:|          ...|::|:|.:|.. |.: 
  Fly   421 SENFQQPIVITPNHLCAQGMPMNDVCRGDSGGPFMDDGTSGVFGTSGRYTIIGIVAFGPTLCGVT 485

  Fly   246 GYPDVFGSVAYYHDWI 261
            ..|.|:..|:.:.|||
  Fly   486 TIPGVYTLVSSFSDWI 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 67/269 (25%)
Tryp_SPc 42..263 CDD:238113 68/270 (25%)
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 67/269 (25%)
Tryp_SPc 252..501 CDD:238113 66/266 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437251
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.