DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and CG34171

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster


Alignment Length:288 Identity:70/288 - (24%)
Similarity:129/288 - (44%) Gaps:51/288 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VLISVLVILSQCSAKSVKIHRRHQLNH-HLGHVKPETRVIGGVDSPTGFAPYQVSI-----MNTF 63
            :|:.:.::|.: :..::||:..|:..: ||                   :.|.||:     ::|.
  Fly     7 LLLKIALVLPK-NITTIKINHYHEPTYSHL-------------------SSYLVSLRTRKYIHTP 51

  Fly    64 GE-HVCGGSIIAPQWILTAAHC-------MEWPIQYLKIVTGTVDYTRPGAEYLVDGSKIHCSHD 120
            |: |.|.|.|:..:.:||:|||       |..|.:.:..:..::..|....|::||   ||....
  Fly    52 GDNHFCTGVILTNRHVLTSAHCITDKNGVMMSPKRIVVALCASLFKTPESEEFVVD---IHNMII 113

  Fly   121 KPAY----HNDIALIHTAKPIVYD-DLTQPIKLASKGSLPKVGDKLTLTG-WG-STKTWGRYSTQ 178
            .|.|    |||||:|...:.:..| ....|:.|.: .||....|..|:.| :| ..:.:|.:.:.
  Fly   114 HPYYHRNQHNDIAIIKLKRYVKLDGHHLAPVVLGN-SSLEVGNDCKTIGGIFGVRRQRFGSFHSM 177

  Fly   179 LQKIDLNYIDHDNC---QSRVRNANWLSEGHVCTFTQEGEGSCHGDSGGPLVDANQTLVGVVNWG 240
            | .:::.....|.|   :..:..|...:|..:|..:.|.: .|..|.||||....| |.|:....
  Fly   178 L-LVNVELRPFDECLKVKKSLMAARPENEDLICVKSTEKQ-MCTTDFGGPLFCDGQ-LYGIALGS 239

  Fly   241 EACAIGYPDVFGSVAYYHDWIEQMMTDA 268
            ..|:...|..|..|::|:.|:.:::::|
  Fly   240 INCSSPDPVFFSDVSFYNSWVTKIISEA 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 61/242 (25%)
Tryp_SPc 42..263 CDD:238113 62/243 (26%)
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 63/256 (25%)
Tryp_SPc 38..263 CDD:304450 62/231 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436940
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.