DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and si:dkey-33m11.7

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_021335658.1 Gene:si:dkey-33m11.7 / 565163 ZFINID:ZDB-GENE-141216-115 Length:214 Species:Danio rerio


Alignment Length:200 Identity:52/200 - (26%)
Similarity:85/200 - (42%) Gaps:37/200 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 GTVDYTRPGAEYLVDGSKIHCSHDKPAYHNDIALIHTAKPIVYDDLTQPIKLASKGSLPK----- 156
            ||..|::|  ..|:.    |..:::...:.||.||..:.||   :|.:.:.||   .|||     
Zfish    18 GTEQYSKP--LMLIP----HPLYNRSTNNADIMLIKLSAPI---ELNRYVSLA---PLPKQNTGL 70

  Fly   157 -VGDKLTLTGWGSTK-TWGRYSTQLQKIDLNYIDHDNCQSRVRNANWLSEGHVCTFTQEGEGS-- 217
             .|....::|||||. :.|.....|:.:.|..:....|.|....:..::...:|..:..|...  
Zfish    71 LAGRMCRVSGWGSTSHSGGLIPLTLRTVRLPIVSTFKCNSSSSFSGNITANMICAGSSTGGKDAC 135

  Fly   218 --------------CHGDSGGPLVDANQTLVGVVNWGEACA-IGYPDVFGSVAYYHDWIEQMMTD 267
                          |.|||||||| .:..:.|:|:||..|. ..:|.|:.:|:.:..||:|.:..
Zfish   136 KNSTQYLCHLIVYLCQGDSGGPLV-CDGRVYGLVSWGNGCGDPRFPGVYTAVSRFRRWIDQTIYS 199

  Fly   268 AGTAC 272
            ....|
Zfish   200 TYARC 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 48/187 (26%)
Tryp_SPc 42..263 CDD:238113 50/189 (26%)
si:dkey-33m11.7XP_021335658.1 Tryp_SPc <2..196 CDD:238113 50/190 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.