DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and si:dkey-33m11.8

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_693464.3 Gene:si:dkey-33m11.8 / 565078 ZFINID:ZDB-GENE-141215-49 Length:251 Species:Danio rerio


Alignment Length:274 Identity:84/274 - (30%)
Similarity:129/274 - (47%) Gaps:48/274 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KCLVLISVLVILSQCSAKSVKIHRRHQLNHHLGHVKPETRVIGGVDSPTGFAPYQVSIM-NTFGE 65
            |||....:|::.....:|                   :.|:|||.:.......||.|:. |.:  
Zfish     3 KCLEYTLLLIVSMLQGSK-------------------QQRIIGGQEVQPYSIKYQASVQYNNY-- 46

  Fly    66 HVCGGSIIAPQWILTAAHCMEWPIQYL-KIVTGTVDYTR-PGAEYLVDGSK--IHCSHDKPAYHN 126
            |.|||::|.|||:::||||  |...|| |:|....|.:: .|.|.:.:.||  :|..::...:.:
Zfish    47 HYCGGTLIHPQWVVSAAHC--WRPSYLIKVVLSEHDLSKIEGFERVFNVSKALVHYMYNYRTFDS 109

  Fly   127 DIALIHTAKPIVYDDLTQPIKLASKGSLPKV--GDKLTLTGWGSTKTWGRY-STQLQKIDLNYID 188
            ||.|:...||.......||..|..  |:|.:  |....::|||.|:.:..| |..|:.:|:..| 
Zfish   110 DIMLLKLEKPAELSATIQPAVLPV--SVPALQGGTVCIVSGWGVTQVYSYYLSPVLRAVDVQII- 171

  Fly   189 HDNCQ----SRVRNANWLSEGHVCTFTQ-EGEGSCHGDSGGPLVDANQTLVGVVNWGEACAIGY- 247
             ..||    .|:      ::..||..:. .|:.||.|||||||: .|....|:|:||.:||..| 
Zfish   172 -PQCQYYYYYRI------TDNMVCAGSPLGGKDSCQGDSGGPLI-CNGYFEGIVSWGISCANAYF 228

  Fly   248 PDVFGSVAYYHDWI 261
            |.|:..|..|..|:
Zfish   229 PGVYTKVRNYIPWM 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 78/233 (33%)
Tryp_SPc 42..263 CDD:238113 78/234 (33%)
si:dkey-33m11.8XP_693464.3 Tryp_SPc 23..241 CDD:214473 78/232 (34%)
Tryp_SPc 24..241 CDD:238113 77/231 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.