DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and prss1

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001015792.1 Gene:prss1 / 548509 XenbaseID:XB-GENE-5776262 Length:244 Species:Xenopus tropicalis


Alignment Length:270 Identity:83/270 - (30%)
Similarity:122/270 - (45%) Gaps:40/270 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKCLVLISVLVILSQCSAKSVKIHRRHQLNHHLGHVKPETRVIGGVDSPTGFAPYQVSIMNTFGE 65
            ||.|:   |||:|....|                 .:.:.:::||........|||||:  ..|.
 Frog     1 MKFLI---VLVLLGAAVA-----------------FEDDDKIVGGFTCTKNAVPYQVSL--NAGY 43

  Fly    66 HVCGGSIIAPQWILTAAHCMEWPIQYLKIVTGTVDYTRPGAEYLVDGSKI--HCSHDKPAYHNDI 128
            |.||||:|..||:::||||.:..|| :::....: ....|.|..::..|:  |.|::.....|||
 Frog    44 HFCGGSLINSQWVVSAAHCYKSRIQ-VRLGEHNI-AVNEGTEQFIESQKVIKHPSYNSRNLDNDI 106

  Fly   129 ALIHTAKPIVYDDLTQPIKLASKGSLPKVGDKLTLTGWGSTKTWG-RYSTQLQKIDLNYIDHDNC 192
            .||..:.........|.:.|.|  :....|....::|||:|.:.| .|...||.::...:....|
 Frog   107 MLIKLSTTARLSSNIQSVPLPS--ACASAGTNCLISGWGNTLSSGTNYPDLLQCLNAPILTASEC 169

  Fly   193 QS----RVRNANWLSEGHVCTFTQEGEGSCHGDSGGPLVDANQTLVGVVNWGEACA-IGYPDVFG 252
            .:    .:.| |....|    |...|:.||.||||||:| .|..|.|||:||..|| ..||.|:.
 Frog   170 SNSYPGEITN-NMFCAG----FLAGGKDSCQGDSGGPVV-CNGQLQGVVSWGYGCAQRNYPGVYT 228

  Fly   253 SVAYYHDWIE 262
            .|..|..||:
 Frog   229 KVCNYVSWIQ 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 73/227 (32%)
Tryp_SPc 42..263 CDD:238113 75/229 (33%)
prss1NP_001015792.1 Tryp_SPc 22..240 CDD:238113 75/229 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.