DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and epsilonTry

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster


Alignment Length:270 Identity:88/270 - (32%)
Similarity:142/270 - (52%) Gaps:27/270 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKCLVLISVLVILSQCS-AKSVKIHRRHQLNHHLGHVKPETRVIGGVDSPTGFAPYQVSIMNTFG 64
            :|..||:|||.    |: |.::......||         :.|::||.::.....|||||:.. :|
  Fly     2 LKFAVLLSVLA----CALAGTIPDGLLPQL---------DGRIVGGYETSIDAHPYQVSLQR-YG 52

  Fly    65 EHVCGGSIIAPQWILTAAHCME-WPIQYLKIVTGTVDYTRPGAEYLVDGSKIHCSHDKPAYHNDI 128
            .|.|||||.:...::|||||:: ...:.|||..|:..:...|:.:.|...:.|..::.....|||
  Fly    53 SHFCGGSIYSHDIVITAAHCLQSIEAKDLKIRVGSTYWRSGGSVHSVRSFRNHEGYNSRTMVNDI 117

  Fly   129 ALIHTAKPIVYDDLTQPIKLASKGSLPKVGDKLTLTGWGSTKTWGRYST---QLQKIDLNYIDHD 190
            |:|.....:.:....:.|::|.  |.|:.|....::|||:|::.|  ||   .|..:||..||..
  Fly   118 AIIRIESDLSFRSSIREIRIAD--SNPREGATAVVSGWGTTESGG--STIPDHLLAVDLEIIDVS 178

  Fly   191 NCQS-RVRNANWLSEGHVCTFTQEGEGSCHGDSGGPLVDANQTLVGVVNWGEACA-IGYPDVFGS 253
            .|:| .......:.:..:|.:... :.:|.||||||||..:: |||||:||..|. :.||.|:..
  Fly   179 RCRSDEFGYGKKIKDTMLCAYAPH-KDACQGDSGGPLVSGDR-LVGVVSWGYGCGDVRYPGVYAD 241

  Fly   254 VAYYHDWIEQ 263
            ||::|:|||:
  Fly   242 VAHFHEWIER 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 75/225 (33%)
Tryp_SPc 42..263 CDD:238113 76/226 (34%)
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 75/225 (33%)
Tryp_SPc 31..252 CDD:238113 77/228 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.