DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and zgc:92590

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001007055.1 Gene:zgc:92590 / 474322 ZFINID:ZDB-GENE-041024-15 Length:247 Species:Danio rerio


Alignment Length:270 Identity:76/270 - (28%)
Similarity:123/270 - (45%) Gaps:44/270 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LVLISVLVILSQCSAKSVKIHRRHQLNHHLGHVKPETRVIGGVDSPTGFAPYQVSIMNTFGEHVC 68
            :::.::||:...|||                    :.::|||.:......|:|:.:....|:..|
Zfish     3 MIVFALLVLAVACSA--------------------DDKIIGGYECSPNSQPWQIYLTYDNGQRWC 47

  Fly    69 GGSIIAPQWILTAAHCMEWPIQYLKIVTGTVDY------TRPGAEYLVDGSKI--HCSHDKPAYH 125
            |.|:|..:|.::||||      ||.....||..      ...|.|..:...|:  |..::.....
Zfish    48 GASLINDRWAVSAAHC------YLVANRLTVHLGEHNVAVEEGTEQRIKAEKVIPHPKYNDYTLD 106

  Fly   126 NDIALIHTAKPIVYDDLTQPIKLASKGSLPKVGDKLTLTGWGSTKTWG-RYSTQLQKIDLNYIDH 189
            ||..||...:|.|::...||:.|.:  |....|::..::|||:....| .|...||.::|..:..
Zfish   107 NDFMLIKLKEPAVFNQYVQPVPLTT--SCSSEGEQCLVSGWGNLINTGVVYPDVLQCLNLPVLTR 169

  Fly   190 DNCQSRVRNANW-LSEGHVCT-FTQEGEGSCHGDSGGPLVDANQTLVGVVNWGEACA-IGYPDVF 251
            ..|:...   .| :::...|. |.:.|:.:|.||||||:: .|..|.|||:||..|| .|||.|:
Zfish   170 AQCEGAY---GWQITKNMFCAGFMEGGKDACQGDSGGPVI-CNGELRGVVSWGYGCADSGYPGVY 230

  Fly   252 GSVAYYHDWI 261
            ..|..|.||:
Zfish   231 TEVCRYTDWV 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 70/231 (30%)
Tryp_SPc 42..263 CDD:238113 71/232 (31%)
zgc:92590NP_001007055.1 Tryp_SPc 20..240 CDD:214473 70/231 (30%)
Tryp_SPc 21..243 CDD:238113 71/232 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.