DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and Jon99Ci

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster


Alignment Length:281 Identity:89/281 - (31%)
Similarity:125/281 - (44%) Gaps:33/281 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKCLVLISVLVILSQCSAKSVKIHRRHQLNHHLGHVKPETRVIGGVDSPTGFAPYQVSI-MNTFG 64
            |:.|.|:| |..|..|||.:|.....|..:..:.|...|.|:..|..:..|..||.|.: :|:.|
  Fly     1 MRGLTLLS-LAFLGVCSALTVPHSLVHPRDLEIRHGGIEGRITNGNLASEGQVPYIVGVSLNSNG 64

  Fly    65 E-HVCGGSIIAPQWILTAAHCM----EWPIQYLKIVTGTVDYTRPGAEYLVDGSK-IHCSHDKPA 123
            . ..||||||...|:||||||.    |..:.|     |.|:|..|...:.|.... |...|....
  Fly    65 NWWWCGGSIIGHTWVLTAAHCTAGADEASLYY-----GAVNYNEPAFRHTVSSENFIRYPHYVGL 124

  Fly   124 YHNDIALIHTAKPIVYDDLTQPIKLASKGSLPKVGDK--------LTLTGWGSTKTWGRYSTQLQ 180
            .| |:|||.|.....|       .|.:|..||.:.|:        :...|||:..........|:
  Fly   125 DH-DLALIKTPHVDFY-------SLVNKIELPSLDDRYNSYENNWVQAAGWGAIYDGSNVVEDLR 181

  Fly   181 KIDLNYIDHDNCQSRVRNANWLSEGHVCTFTQEGEGSCHGDSGGPLV-DANQTLVGVVNWGEA-- 242
            .:||..|....||: ....:..||..:|..|.:|:.:|.|||||||| .....|:|:.::..|  
  Fly   182 VVDLKVISVAECQA-YYGTDTASENTICVETPDGKATCQGDSGGPLVTKEGDKLIGITSFVSAYG 245

  Fly   243 CAIGYPDVFGSVAYYHDWIEQ 263
            |.:|.|..|..|..|.:||::
  Fly   246 CQVGGPAGFTRVTKYLEWIKE 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 74/237 (31%)
Tryp_SPc 42..263 CDD:238113 75/238 (32%)
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 74/237 (31%)
Tryp_SPc 41..266 CDD:238113 75/238 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436844
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.