DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and Jon99Cii

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster


Alignment Length:243 Identity:81/243 - (33%)
Similarity:110/243 - (45%) Gaps:42/243 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RVIGGVDSPTGFAPYQVSIM-NTFGEHVCGGSIIAPQWILTAAHCMEWPIQYLKIVTG-TVDY-- 101
            |:..|..:..|..||.|.:: :..|...||||||...|:||||||...       .:| |::|  
  Fly    35 RITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNG-------ASGVTINYGA 92

  Fly   102 ---TRPGAEYLVDGSKI--HCSHDKPAYHNDIALIHTAKPIVYDDLTQPIKLASKGSLPKVGDK- 160
               |:|...:.|....|  |..::....||||:||.|.....:       .|.:|..||...|: 
  Fly    93 SIRTQPQYTHWVGSGDIIQHHHYNSGNLHNDISLIRTPHVDFW-------SLVNKVELPSYNDRY 150

  Fly   161 -------LTLTGWGSTKTWGRYSTQLQKIDLNYIDHDNCQSRVRNANW-LSEGHVCTFTQEGEGS 217
                   ...:|||.|.........||.:|:..|...:|     :..| |.:..:|..|..|:.:
  Fly   151 QDYAGWWAVASGWGGTYDGSPLPDWLQSVDVQIISQSDC-----SRTWSLHDNMICINTDGGKST 210

  Fly   218 CHGDSGGPLV--DANQTLVGVVNWGEA--CAIGYPDVFGSVAYYHDWI 261
            |.||||||||  |.|: ||||.::|.|  |..|.|.||..|..|.|||
  Fly   211 CGGDSGGPLVTHDGNR-LVGVTSFGSAAGCQSGAPAVFSRVTGYLDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 79/241 (33%)
Tryp_SPc 42..263 CDD:238113 80/242 (33%)
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 80/242 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436826
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.