DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and CG11841

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:218 Identity:55/218 - (25%)
Similarity:99/218 - (45%) Gaps:31/218 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 CGGSIIAPQWILTAAHCM---EWPIQYLKIVTGTVDYTRPGAE---YLVDGSKIHCSHDKPAYHN 126
            |||::|:.:.:||||||.   ...:..:::.....|.....||   :.|...|.|...:.|..:|
  Fly   102 CGGTLISNRLVLTAAHCFFSEHGEVNVVRLGELEFDTDTDDAEPEDFGVLALKAHPGFENPQLYN 166

  Fly   127 DIALIHTAKPIVYDDLTQPIKLASKGSLP----KVGDKLTLTGWGSTKTWGRYSTQLQKIDL-NY 186
            ||.::...:.:.::....|      ..||    :..:.....|||..|...:.|.:|.|:.| .|
  Fly   167 DIGIVQLDREVKFNRYKHP------ACLPFDDGEQHESFIAIGWGQKKFAQKESKKLLKVQLQGY 225

  Fly   187 IDHDNCQSRVRNANWLSEGH-----VCTFTQEGEGSCHGDSGGPLVDANQTL------VGVVNWG 240
              .|.|.|.|...:.|..|:     :|..:::.:.:|:||||||::..::.|      :|:.:.|
  Fly   226 --KDRCVSSVDANDELPNGYEPKSQLCIGSRDNKDTCNGDSGGPVLAYHKDLACMYHVMGITSAG 288

  Fly   241 EACAI-GYPDVFGSVAYYHDWIE 262
            ..|:. ..|..:..|.|:.:||:
  Fly   289 ITCSTPDIPSAYTRVHYFLNWIK 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 53/215 (25%)
Tryp_SPc 42..263 CDD:238113 55/218 (25%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 54/216 (25%)
Tryp_SPc 72..310 CDD:214473 53/215 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437663
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.