DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and CG4815

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:256 Identity:64/256 - (25%)
Similarity:103/256 - (40%) Gaps:52/256 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VKPETRVIGGVDSPTGFAPYQVSIMNTFGEH-VCGGSIIAPQWILTAAHCMEWPIQYLK--IVTG 97
            :|.....:|||.         :.:.|  |.. ||..:::.|:.|||||||.| .:...|  ::.|
  Fly    39 IKTTVESLGGVG---------IQLFN--GRKLVCSATLLTPRHILTAAHCFE-NLNRSKFHVIGG 91

  Fly    98 TVDYTRPGAEYLVDGS----------KIHCSHDKPAYHNDIALIHTAKP-----IVYDDLTQPIK 147
                  ..||:...|:          :||..:.|..:..|:|:..|..|     |.|..|.:   
  Fly    92 ------KSAEFTWHGNNFNKNKLIRVQIHPKYAKMKFIADVAVAKTKYPLRSKYIGYAQLCR--- 147

  Fly   148 LASKGSLPKVGDKLTLTGWG-STKTW--GRYSTQLQKIDLNYIDHDNCQSRVRNANWLSEGHVCT 209
                 |:....|||...||| ....|  .|..| .:.:.:..:...:|:.::...  :....:|.
  Fly   148 -----SVLHPRDKLIAAGWGFEGGVWDESRKKT-FRSMKVGIVSKRDCEKQLDRK--MPPNIICA 204

  Fly   210 FTQEGEGSCHGDSGGPLVDANQTLVGVVNWGEACAIG-YPDVFGSVAYYHDWIEQMMTDAG 269
            .....:..|.|||||||:...| :.|:..|...|... .|||:..|.||..:|::.:...|
  Fly   205 GAYNNKTLCFGDSGGPLLLGRQ-VCGINTWTFKCGNNEKPDVYMGVRYYAKFIKRTINRMG 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 61/241 (25%)
Tryp_SPc 42..263 CDD:238113 62/242 (26%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 60/239 (25%)
Trypsin 49..256 CDD:278516 59/236 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436934
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.