DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and CG16710

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:291 Identity:73/291 - (25%)
Similarity:120/291 - (41%) Gaps:75/291 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 HLGHVKPET----------RVIGGVDSPTGFAPYQVSIM------NTFGEHV---CGGSIIAPQW 77
            ::||:.|.|          |:.||.::.....|:...|:      :.:.|.:   |.||:|..::
  Fly    86 NMGHILPNTQICGPIMPAYRIFGGEETQPNELPWMALILYAHRSRSVWNERLVSRCAGSLITNRY 150

  Fly    78 ILTAAHCMEWPIQYLKIVTGTVDYTR-----------PGAEYLVDGSKIHCS------------- 118
            :||||||:.        :|| :|..|           |.....::|.: ||:             
  Fly   151 VLTAAHCLR--------ITG-LDLRRVRLGEHNILSNPDCVTHINGRE-HCAPEHLEIDVDLSIK 205

  Fly   119 -------HDKPAYHNDIALIHTAKPIVYDDLTQPI--KLASKGSLPKVGD-KLTLTGWGSTKTWG 173
                   .::|  :|||||:....|:.|....:||  :|....|.|...: ||.:.|||.:...|
  Fly   206 HRHYMVFEERP--YNDIALLRLKFPVRYTAQIKPICVQLDYIFSNPSFSNHKLQIAGWGLSHKQG 268

  Fly   174 RYSTQLQKIDLNYIDHDNCQSRVRNANWLSEGHVCTFTQEGEGSCHGDSGGPLVDANQT------ 232
             ||..|.:..:|..:.|.|.....:.....|.|:|.....|..:|.|||||||:...:.      
  Fly   269 -YSNVLLQAYVNGRNADECSLSEPSLGLDKETHICAGNLGGNDTCKGDSGGPLMAIMERGDEEFV 332

  Fly   233 -LVGVVNWG-EACAIGYPDVFGSVAYYHDWI 261
             |.|:.::| ..|..| |..:...:.:.:||
  Fly   333 YLAGITSYGYSQCGYG-PAAYTKTSKFVEWI 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 67/270 (25%)
Tryp_SPc 42..263 CDD:238113 68/271 (25%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855
Tryp_SPc 105..362 CDD:214473 67/270 (25%)
Tryp_SPc 106..362 CDD:238113 66/269 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437227
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.