DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and CG31199

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_732546.1 Gene:CG31199 / 42456 FlyBaseID:FBgn0051199 Length:293 Species:Drosophila melanogaster


Alignment Length:237 Identity:54/237 - (22%)
Similarity:85/237 - (35%) Gaps:64/237 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 CGGSIIAPQWILTAAHCMEWPIQYLKI--------------------VTGTVDY-TRPGAEYLVD 111
            |.|.:::.:.:|..|||.   :||..:                    |..|..| .||..|..:.
  Fly    71 CLGVLVSKRTVLAPAHCF---VQYNGVAEAFSVHLGVHNKSAPVGVRVCETDGYCVRPSQEIKLA 132

  Fly   112 GSKIHCSHDKPAYHNDIALI---HTAKPIVYDDLTQPIKLASKGSLPK--VGDKLTLTGWG---- 167
            ...||..:|.....|.:|::   ..||  :|.:: .||.:.....|.:  |.....:.|..    
  Fly   133 EIAIHPDYDSRTLKNSLAVLTLQRDAK--IYPNV-MPICMPPPSLLNETLVAQTFVVAGLRVFED 194

  Fly   168 -STKTWGRYSTQLQKIDLNYIDHDNCQSRVRNANWLSEGHVCTFTQEGEGSCHGDSGGPL----- 226
             ..|||           :|.:....|||:|:.. ..|...||.:.::.....   .|.||     
  Fly   195 FRLKTW-----------VNTLSRGFCQSKVKTL-VTSSNTVCGYHKQPVAYY---LGAPLVGLQK 244

  Fly   227 ---VDANQTLVGV-VNW-GEACAIGYPDVFGSVAYYHDWIEQ 263
               |..|..|||: ::| .|...|  ...|.::..|.|:|.|
  Fly   245 KGHVTQNYYLVGIMIDWRWENNRI--MSSFLAIRNYMDFIRQ 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 52/233 (22%)
Tryp_SPc 42..263 CDD:238113 53/235 (23%)
CG31199NP_732546.1 Tryp_SPc 45..257 CDD:304450 45/206 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.