DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and CG31266

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster


Alignment Length:238 Identity:104/238 - (43%)
Similarity:141/238 - (59%) Gaps:5/238 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 HHLGHVKPETRVIGGVDSPTGFAPYQVSIMNTFGEHVCGGSIIAPQWILTAAHCMEW--PIQYLK 93
            |......|:.|||||..:..|..|:..||.|.:..|:||..|:...|:||||.|:..  |:..| 
  Fly    41 HRSTEAVPQGRVIGGTTAAEGNWPWIASIQNAYSYHLCGAIILDETWVLTAASCVAGLRPLNLL- 104

  Fly    94 IVTGTVDYTRPGAE-YLVDGSKIHCSHDKPAYHNDIALIHTAKPIVYDDLTQPIKLASKGSLPKV 157
            :||||||:....|. |.|....:||:.|||.|||||||:..:..|.::|:|:.|.||....|.: 
  Fly   105 VVTGTVDWWDLYAPYYTVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDVTKNITLADIDELEE- 168

  Fly   158 GDKLTLTGWGSTKTWGRYSTQLQKIDLNYIDHDNCQSRVRNANWLSEGHVCTFTQEGEGSCHGDS 222
            |||||..||||::..|.|...||:....|:..|.|:.:::|.:.:..||||.....|:|:||||:
  Fly   169 GDKLTFAGWGSSEAMGTYGRYLQEASGTYLPVDACREKLQNQDDVDLGHVCVQMDAGQGACHGDT 233

  Fly   223 GGPLVDANQTLVGVVNWGEACAIGYPDVFGSVAYYHDWIEQMM 265
            ||||:|..|.|||:.|||..|..|||||:...|:|||||...|
  Fly   234 GGPLIDEQQRLVGIGNWGVPCGRGYPDVYARTAFYHDWIRTTM 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 99/222 (45%)
Tryp_SPc 42..263 CDD:238113 100/223 (45%)
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 99/222 (45%)
Tryp_SPc 52..275 CDD:238113 100/224 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D104368at6960
OrthoFinder 1 1.000 - - FOG0007620
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.