DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5246 and CG31265

DIOPT Version :9

Sequence 1:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster


Alignment Length:275 Identity:110/275 - (40%)
Similarity:158/275 - (57%) Gaps:30/275 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LVLISVLVIL-----SQCSAKSVKIHRRHQLNHHLGHVKP-----ETRVIGGVDSPTGFAPYQVS 58
            |:.:|:|::|     :.|.:|.:              |.|     ..|:.||.::..||||||||
  Fly     3 LLRLSLLILLAVKPPNPCESKRI--------------VGPFPAGQSGRIKGGEEAEIGFAPYQVS 53

  Fly    59 IMNTFGEHVCGGSIIAPQWILTAAHCMEWPIQYL-KIVTGTVDYTRPGAEYLVDGSKIHCSHDKP 122
            :....|.|.|||:|:...||:||.||:|..|..| .::|||..:..|||.|.......||.:|:|
  Fly    54 LQPIVGSHNCGGAILNENWIITAGHCVENFIPALVNVITGTNKWAEPGAIYYTAEIHKHCMYDQP 118

  Fly   123 AYHNDIALIHTAKPIVYDDLTQPIKLASKGSLP-KVGDKLTLTGWGSTKTWGRYSTQLQKIDLNY 186
            ..||||||:...:.|.:::|||||.|.::   | ::|:::.||||||...:|.....|.|:.:..
  Fly   119 YMHNDIALVKLTENITFNELTQPIALPTR---PVQLGEEIVLTGWGSDVAYGSSMEDLHKLTVGL 180

  Fly   187 IDHDNCQSRVRNANWLSEGHVCTFTQEGEGSCHGDSGGPLVDANQTLVGVVNWGEACAIGYPDVF 251
            :..|.|.......:.:..||:|||::||||:|||||||||| :|..||||||||..|.:|.|||.
  Fly   181 VPLDECYETFNRTSSMGVGHICTFSREGEGACHGDSGGPLV-SNGQLVGVVNWGRPCGVGLPDVQ 244

  Fly   252 GSVAYYHDWIEQMMT 266
            .:|.||.|||...::
  Fly   245 ANVYYYLDWIRSKLS 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 100/221 (45%)
Tryp_SPc 42..263 CDD:238113 101/222 (45%)
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 100/221 (45%)
Tryp_SPc 39..257 CDD:238113 101/221 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BRU4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D104368at6960
OrthoFinder 1 1.000 - - FOG0007620
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.